Knowledge

Ciliate, dasycladacean and hexamita nuclear code

Source 📝

630: 451:
Schneider SU, Leible MB, Yang XP (1989). "Strong homology between the small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase of two species of
321: 351: 382: 52:
The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae.
671: 546: 645: 700: 690: 664: 695: 705: 657: 369: 8: 553:. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine 593: 527: 480: 602: 577: 428: 403: 607: 519: 472: 433: 531: 484: 597: 589: 511: 464: 423: 415: 80: 225: 641: 93: Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG 88: Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG 684: 386: 356: 346: 328: 174: 142: 134: 40: 419: 333: 316: 32: 611: 523: 476: 437: 311: 299: 71: 498:
Schneider SU, de Groot EJ (1991). "Sequences of two rbcS cDNA clones of
578:"A non-canonical genetic code in an early diverging eukaryotic lineage" 515: 468: 305: 190: 170: 158: 130: 63: 339: 293: 186: 154: 146: 637: 194: 138: 126: 103: 45: 83:= TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG 74:= -----------------------------------M---------------------------- 66:= FFLLSSSSYYQQCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG 629: 288: 178: 162: 150: 122: 111: 107: 99: 36: 198: 182: 166: 115: 401: 544: 402:
Hoffman DC, Anderson RC, DuBois ML, Prescott DM (1995).
204: 450: 497: 404:"Macronuclear gene-sized molecules of hypotrichs" 682: 575: 502:: structural and evolutionary considerations". 665: 545:Elzanowski A, Ostell J, Leipe D, Soussov V. 455:and the occurrence of unusual codon usage". 672: 658: 383:United States National Library of Medicine 601: 427: 381:This article incorporates text from the 683: 624: 538: 282: 13: 594:10.1002/j.1460-2075.1996.tb00581.x 205:Differences from the standard code 14: 717: 576:Keeling PJ, Doolittle WF (1996). 569: 628: 457:Molecular & General Genetics 491: 444: 395: 1: 375: 644:. You can help Knowledge by 7: 363: 55: 21:ciliate, dasycladacean and 10: 722: 623: 359:ATCC50330, and ATCC50380. 16:Alternative genetic code 408:Nucleic Acids Research 420:10.1093/nar/23.8.1279 370:List of genetic codes 701:Protein biosynthesis 547:"The Genetic Codes" 500:Batophora oerstedii 210: 27:(translation table 691:Molecular genetics 516:10.1007/bf00312782 469:10.1007/bf00332408 385:, which is in the 209: 62:    653: 652: 322:Glaucoma chattoni 280: 279: 713: 674: 667: 660: 632: 625: 615: 605: 582:The EMBO Journal 563: 562: 560: 558: 551:Taxonomy browser 542: 536: 535: 504:Current Genetics 495: 489: 488: 448: 442: 441: 431: 399: 352:Hexamita inflata 283:Systematic range 276: 269: 264: 259: 252: 245: 240: 235: 211: 208: 94: 89: 84: 75: 67: 35:used by certain 721: 720: 716: 715: 714: 712: 711: 710: 696:Gene expression 681: 680: 679: 678: 621: 572: 567: 566: 556: 554: 543: 539: 496: 492: 449: 445: 400: 396: 378: 366: 285: 274: 267: 262: 257: 250: 243: 238: 233: 207: 92: 87: 78: 70: 61: 58: 17: 12: 11: 5: 719: 709: 708: 706:Genetics stubs 703: 698: 693: 677: 676: 669: 662: 654: 651: 650: 633: 617: 616: 588:(9): 2285–90. 571: 570:External links 568: 565: 564: 537: 510:(1–2): 173–5. 490: 443: 414:(8): 1279–83. 393: 392: 377: 374: 373: 372: 365: 362: 361: 360: 344: 326: 284: 281: 278: 277: 275:STOP = Ter (*) 272: 270: 265: 260: 254: 253: 251:STOP = Ter (*) 248: 246: 241: 236: 230: 229: 223: 221: 218: 215: 206: 203: 96: 95: 90: 85: 76: 68: 57: 54: 15: 9: 6: 4: 3: 2: 718: 707: 704: 702: 699: 697: 694: 692: 689: 688: 686: 675: 670: 668: 663: 661: 656: 655: 649: 647: 643: 640:article is a 639: 634: 631: 627: 626: 622: 619: 613: 609: 604: 599: 595: 591: 587: 583: 579: 574: 573: 552: 548: 541: 533: 529: 525: 521: 517: 513: 509: 505: 501: 494: 486: 482: 478: 474: 470: 466: 463:(3): 445–52. 462: 458: 454: 447: 439: 435: 430: 425: 421: 417: 413: 409: 405: 398: 394: 391: 390: 388: 387:public domain 384: 371: 368: 367: 358: 357:Diplomonadida 354: 353: 348: 347:Diplomonadida 345: 342: 341: 336: 335: 330: 329:Dasycladaceae 327: 324: 323: 319:and probably 318: 314: 313: 308: 307: 302: 301: 296: 295: 290: 287: 286: 273: 271: 266: 261: 256: 255: 249: 247: 242: 237: 232: 231: 227: 226:Standard code 224: 222: 220:This code (6) 219: 216: 213: 212: 202: 200: 196: 192: 188: 184: 180: 176: 175:Phenylalanine 172: 168: 164: 160: 156: 152: 148: 144: 143:Glutamic acid 140: 136: 135:Aspartic acid 132: 128: 124: 121:Amino acids: 119: 117: 113: 109: 105: 101: 91: 86: 82: 77: 73: 69: 65: 60: 59: 53: 50: 48: 47: 42: 41:dasycladacean 38: 34: 30: 26: 24: 646:expanding it 635: 620: 618: 585: 581: 555:. Retrieved 550: 540: 507: 503: 499: 493: 460: 456: 453:Acetabularia 452: 446: 411: 407: 397: 380: 379: 350: 338: 334:Acetabularia 332: 320: 317:Oxytrichidae 310: 304: 298: 292: 120: 97: 51: 44: 33:genetic code 28: 25:nuclear code 22: 20: 18: 312:Tetrahymena 300:Stylonychia 685:Categories 557:29 January 376:References 306:Paramecium 217:RNA codons 214:DNA codons 201:(Val, V). 197:(Tyr, Y), 193:(Trp, W), 191:Tryptophan 189:(Thr, T), 185:(Ser, S), 181:(Pro, P), 177:(Phe, F), 173:(Met, M), 171:Methionine 169:(Lys, K), 165:(Leu, L), 161:(Ile, I), 159:Isoleucine 157:(His, H), 153:(Gly, G), 149:(Gln, Q), 145:(Glu, E), 141:(Cys, C), 137:(Asp, D), 133:(Asn, N), 131:Asparagine 129:(Arg, R), 125:(Ala, A), 340:Batophora 294:Oxytricha 187:Threonine 155:Histidine 147:Glutamine 49:species. 638:genetics 532:13509708 485:31247623 364:See also 195:Tyrosine 139:Cysteine 127:Arginine 110:(G) and 104:cytosine 56:The code 46:Hexamita 23:Hexamita 612:8641293 524:1934113 477:2573818 438:7753617 289:Ciliata 268:Gln (Q) 244:Gln (Q) 179:Proline 163:Leucine 151:Glycine 123:Alanine 114:(T) or 112:thymine 108:guanine 100:adenine 98:Bases: 37:ciliate 31:) is a 610:  603:450153 600:  530:  522:  483:  475:  436:  429:306850 426:  337:, and 199:Valine 183:Serine 167:Lysine 116:uracil 79:  72:Starts 636:This 528:S2CID 481:S2CID 118:(U). 106:(C), 102:(A), 81:Base1 642:stub 608:PMID 559:2016 520:PMID 473:PMID 434:PMID 297:and 228:(1) 43:and 19:The 598:PMC 590:doi 512:doi 465:doi 461:218 424:PMC 416:doi 263:UAG 258:TAG 239:UAA 234:TAA 64:AAs 687:: 606:. 596:. 586:15 584:. 580:. 549:. 526:. 518:. 508:20 506:. 479:. 471:. 459:. 432:. 422:. 412:23 410:. 406:. 355:, 349:: 331:: 315:, 309:, 303:, 291:: 39:, 673:e 666:t 659:v 648:. 614:. 592:: 561:. 534:. 514:: 487:. 467:: 440:. 418:: 389:. 343:. 325:. 29:6

Index

genetic code
ciliate
dasycladacean
Hexamita
AAs
Starts
Base1
adenine
cytosine
guanine
thymine
uracil
Alanine
Arginine
Asparagine
Aspartic acid
Cysteine
Glutamic acid
Glutamine
Glycine
Histidine
Isoleucine
Leucine
Lysine
Methionine
Phenylalanine
Proline
Serine
Threonine
Tryptophan

Text is available under the Creative Commons Attribution-ShareAlike License. Additional terms may apply.