Knowledge

Epidermal growth factor

Source 📝

342: 319: 3301: 241: 216: 3271: 3316: 593: 3286: 348: 247: 1787: 1517:, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents. 1575: 1444: 49: 2057:(DPSCs) because it is capable of increasing extracellular matrix mineralization. A low concentration of EGF (10 ng/ml) is sufficient to induce morphological and phenotypic changes. These data suggests that DPSCs in combination with EGF could be an effective stem cell-based therapy to 75: 355: 254: 3300: 2606:
Fallon JH, Seroogy KB, Loughlin SE, Morrison RS, Bradshaw RA, Knaver DJ, et al. (June 1984). "Epidermal growth factor immunoreactive material in the central nervous system: location and development".
2805:
Yang S, Geng Z, Ma K, Sun X, Fu X (June 2016). "Efficacy of Topical Recombinant Human Epidermal Growth Factor for Treatment of Diabetic Foot Ulcer: A Systematic Review and Meta-Analysis".
2688:
Stortelers C, Souriau C, van Liempt E, van de Poll ML, van Zoelen EJ (July 2002). "Role of the N-terminus of epidermal growth factor in ErbB-2/ErbB-3 binding studied by phage display".
6875: 3270: 6895: 6885: 4664: 5040: 2653:
Dreux AC, Lamb DJ, Modjtahedi H, Ferns GA (May 2006). "The epidermal growth factor receptors and their family of ligands: their putative role in atherogenesis".
6870: 2034:. It can be given by injection into the wound site, or may be used topically. Tentative evidence shows improved wound healing. Safety has been poorly studied. 5405: 2951:"Modification of biodegradable fibrous scaffolds with Epidermal Growth Factor by emulsion electrospinning for promotion of epithelial cells proliferation" 2988:
Del Angel-Mosqueda C, Gutiérrez-Puente Y, López-Lozano AP, Romero-Zavaleta RE, Mendiola-Jiménez A, Medina-De la Garza CE, et al. (September 2015).
1061: 1814:. This stimulates ligand-induced dimerization, activating the intrinsic protein-tyrosine kinase activity of the receptor (see the second diagram). The 1042: 177: 1999:. Disulfide bond formation generates three structural loops that are essential for high-affinity binding between members of the EGF-family and their 6640: 4715: 2725:"A differential requirement for the COOH-terminal region of the epidermal growth factor (EGF) receptor in amphiregulin and EGF mitogenic signaling" 6579: 5756: 4948: 4657: 1868:. Members of this protein family have highly similar structural and functional characteristics. Besides EGF itself other family members include: 7539: 5681: 3315: 7263: 7176: 7121: 7075: 7020: 6755: 6695: 5696: 5626: 5185: 4783: 4725: 2181: 2163: 7258: 7136: 7035: 6821: 6710: 6510: 6470: 6218: 6137: 5999: 5940: 5902: 5847: 5842: 5832: 5706: 5701: 5671: 5646: 5641: 5631: 5517: 5436: 5375: 5303: 5282: 5267: 5220: 4873: 3223: 7358: 7216: 7195: 7151: 7131: 7050: 7030: 6745: 6725: 6705: 6348: 6343: 5676: 5400: 4933: 4730: 4161: 4133: 4030: 7181: 7171: 7126: 7080: 7070: 7025: 6849: 6816: 6796: 6760: 6750: 6700: 6660: 6132: 6112: 6079: 5960: 5862: 5711: 4650: 1301: 1308: 7141: 7040: 6935: 6839: 6791: 6784: 6770: 6715: 6685: 6165: 6155: 6107: 6089: 6018: 5852: 5691: 5636: 2902:"Fabrication and surface modification of poly lactic acid (PLA) scaffolds with epidermal growth factor for neural tissue engineering" 6880: 6570: 3356: 2559:"Epidermal growth factor receptor dimerization and activation require ligand-induced conformational changes in the dimer interface" 1455:
about the entire 1207-aa long gene product: the pro-pre-EGF; what happens if things go wrong (renal hypomagnesemia 4, OMIM 611718).
2492:
Chao J (2013-01-01), Rawlings ND, Salvesen G (eds.), "Chapter 624 - Mouse Kallikrein 9, Epidermal Growth Factor-binding Protein",
6175: 5892: 3989: 3309:: Structure of the extracellular domain of human epidermal growth factor (EGF) receptor in an inactive (low pH) complex with EGF. 3285: 6980: 5160: 4843: 3710: 3705: 3581: 1872: 7558: 7508: 7479: 7426: 5913: 5780: 4231: 3250: 3086:
Boonstra J, Rijken P, Humbel B, Cremers F, Verkleij A, van Bergen en Henegouwen P (May 1995). "The epidermal growth factor".
3060: 2509: 2473: 2102: 2146: 7596: 7237: 7233: 7229: 7225: 4778: 4762: 3913: 3782: 3777: 3772: 72: 5506: 5425: 5292: 5209: 2125: 7221: 3874: 3846: 3764: 2094: 6910: 6029: 5589: 5200: 3384: 341: 4858: 4802: 4793: 4334: 2016: 1807: 1507: 1380: 7432: 3908: 3670: 3599: 2150: 2129: 318: 2290:"A comparative profile of total protein and six angiogenically-active growth factors in three platelet products" 7519: 7495: 6635: 6191: 6054: 4440: 4063: 3999: 3893: 3731: 3399: 3203: 2533: 1647: 1106: 7485: 4455: 3923: 3898: 1087: 7529: 5925: 5807: 5797: 4512: 4507: 4249: 3964: 3658: 3653: 3349: 1593: 1458: 240: 215: 157: 6900: 3994: 3974: 3787: 3549: 2851:
Martí-Carvajal AJ, Gluud C, Nicola S, Simancas-Racines D, Reveiz L, Oliva P, et al. (October 2015).
2012: 7514: 5340: 4620: 4502: 3643: 3626: 3591: 3428: 3279:: Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor Extracellular Domains. 2086: 1725: 354: 253: 7422: 4625: 3243: 3040: 4183: 347: 246: 144: 5606: 5522: 5441: 5308: 5225: 4254: 3813: 3373: 3217: 3213: 2949:
Tenchurin T, Lyundup A, Demchenko A, Krasheninnikov M, Balyasin M, Klabukov I, et al. (2017).
1376: 1280: 1276: 1255: 1247: 1243: 1217: 1213: 1188: 1180: 1176: 165: 2764:
Berlanga J, Fernández JI, López E, López PA, del Río A, Valenzuela C, et al. (January 2013).
7601: 7206: 4953: 4483: 3792: 3342: 1803: 1733:
Stimulates incorporation of sulfates into cartilage, exerts insulin-like action on certain cells
2990:"Epidermal growth factor enhances osteogenic differentiation of dental pulp stem cells in vitro" 1284: 1251: 1209: 1184: 7490: 7106: 7010: 6630: 6049: 5035: 4673: 4329: 4306: 4058: 3839: 2054: 2038: 2394:"Epidermal growth factor-urogastrone: biological activity and receptor binding of derivatives" 7564: 5761: 5045: 4684: 4075: 2987: 4038: 7504: 6890: 5822: 5771: 3236: 2616: 2090: 229: 31: 2666: 2346:
Venturi S, Venturi M (2009). "Iodine in evolution of salivary glands and in oral health".
8: 7606: 6645: 6059: 4615: 4221: 4216: 4188: 4151: 3984: 3969: 3933: 3808: 2098: 2031: 2027: 1819: 1709: 1583: 1550: 1419: 185: 2620: 1457:
Please expand the section to include this information. Further details may exist on the
6323: 4676: 3956: 3111: 3016: 2989: 2970: 2926: 2901: 2877: 2852: 2830: 2583: 2558: 2557:
Dawson JP, Berger MB, Lin CC, Schlessinger J, Lemmon MA, Ferguson KM (September 2005).
2501: 2371: 2314: 2289: 2030:
human epidermal growth factor, sold under the brand name Heberprot-P, is used to treat
1933: 1403: 189: 2262: 2245: 2217: 976: 971: 966: 961: 956: 951: 946: 941: 936: 931: 926: 921: 916: 911: 906: 901: 896: 891: 886: 881: 876: 871: 866: 861: 856: 851: 846: 841: 836: 831: 826: 821: 816: 811: 806: 801: 796: 791: 786: 781: 776: 771: 766: 761: 756: 751: 735: 730: 725: 720: 715: 710: 705: 700: 695: 690: 674: 669: 664: 659: 654: 649: 644: 639: 634: 6950: 4143: 3832: 3175: 3170: 3153: 3140: 3103: 3056: 3052: 3021: 2931: 2882: 2822: 2787: 2746: 2705: 2670: 2632: 2588: 2574: 2539: 2529: 2505: 2469: 2446: 2405: 2393: 2363: 2319: 2267: 2221: 2066: 1835: 137: 65: 4642: 3115: 2974: 2834: 2782: 2765: 2375: 7368: 6500: 4110: 4105: 3165: 3132: 3095: 3048: 3011: 3001: 2962: 2921: 2913: 2900:
Haddad T, Noel S, Liberelle B, El Ayoubi R, Ajji A, De Crescenzo G (January 2016).
2872: 2868: 2864: 2814: 2777: 2736: 2697: 2662: 2624: 2578: 2570: 2497: 2436: 2355: 2309: 2301: 2257: 2213: 1791: 434: 365: 309: 264: 2917: 169: 4435: 4068: 3863: 3563: 3207: 3154:"Epidermal growth factor gene polymorphism and development of cutaneous melanoma" 2441: 2424: 2042: 1865: 1859: 1847: 1839: 1815: 1811: 409: 193: 3123:
Dvorak B (March 2004). "Epidermal growth factor and necrotizing enterocolitis".
2186:
National Center for Biotechnology Information, U.S. National Library of Medicine
2168:
National Center for Biotechnology Information, U.S. National Library of Medicine
7554: 7475: 7417: 7111: 6960: 6955: 6069: 6064: 4710: 4700: 4695: 4587: 4556: 4528: 4473: 4085: 4016: 2359: 1996: 1487: 1396: 510: 4368: 3136: 3006: 7590: 7248: 7161: 7090: 7060: 6995: 6905: 6859: 6735: 6665: 6610: 6599: 6084: 5792: 5475: 5380: 5272: 4597: 4373: 3365: 2818: 2078: 1588: 1554: 1423: 1388: 621: 2741: 2724: 2628: 2543: 1995:
This sequence contains six cysteine residues that form three intramolecular
570: 448: 7574: 7544: 7283: 7273: 7166: 7065: 6920: 6740: 6675: 6590: 6094: 5897: 5736: 5731: 5651: 5601: 5415: 5169: 5150: 5129: 5100: 4823: 4818: 4380: 4316: 4301: 4264: 4211: 4178: 3918: 3885: 3179: 3144: 3099: 3025: 2935: 2886: 2826: 2791: 2750: 2709: 2674: 2592: 2450: 2367: 2323: 2225: 2062: 2000: 1907: 1901: 1884: 1823: 1558: 1546: 1407: 427: 206: 3107: 2636: 2409: 2271: 1348: 1343: 927:
positive regulation of epidermal growth factor-activated receptor activity
592: 7534: 7500: 7398: 7388: 7383: 7373: 7323: 7146: 7045: 6806: 6720: 6650: 6545: 6308: 6273: 6223: 6186: 6122: 6004: 5935: 5887: 5877: 5872: 5867: 5751: 5746: 5741: 5119: 5030: 5020: 4988: 4983: 4978: 4973: 4963: 4923: 4888: 4564: 4541: 4043: 3946: 3195:
Shaanxi Zhongbang Pharma-Tech Co., Ltd.-Supply of Epidermal Growth Factor
2850: 2058: 1486:(sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a 1372: 1151: 1132: 752:
negative regulation of epidermal growth factor receptor signaling pathway
2766:"Heberprot-P: a novel product for treating advanced diabetic foot ulcer" 2101:. For these discoveries Levi-Montalcini and Cohen were awarded the 1986 7353: 7318: 7313: 7303: 7293: 7211: 7000: 6975: 6965: 6811: 6765: 6625: 6451: 6420: 6389: 6358: 6303: 6278: 6258: 6243: 6233: 6127: 6044: 5837: 5817: 5716: 5661: 5656: 5480: 5385: 5370: 5165: 5124: 5096: 5065: 5025: 4928: 4883: 4878: 4853: 4848: 4838: 4751: 4745: 4735: 4592: 4478: 4128: 4080: 4009: 4004: 3614: 3609: 3604: 2966: 2948: 2305: 1989: 1925: 1919: 1913: 1890: 1831: 1483: 1392: 326: 223: 173: 2701: 2687: 1786: 847:
positive regulation of cerebellar granule cell precursor proliferation
114: 110: 106: 102: 98: 94: 7378: 7348: 7343: 7338: 7333: 7328: 7308: 7298: 7288: 7278: 6970: 6930: 6826: 6801: 6560: 6555: 6550: 6540: 6535: 6530: 6520: 6441: 6379: 6313: 6293: 6288: 6283: 6268: 6263: 6253: 6248: 6142: 6117: 5882: 5802: 5721: 5666: 5556: 5495: 5485: 5390: 5277: 5075: 5070: 5060: 4968: 4958: 4943: 4918: 4913: 4903: 4898: 4893: 4395: 4324: 4206: 4118: 4053: 3979: 3715: 3571: 1878: 1795: 1663: 1495: 1006: 912:
activation of transmembrane receptor protein tyrosine kinase activity
393: 380: 292: 279: 181: 3200: 2950: 2204:
Harris RC, Chung E, Coffey RJ (March 2003). "EGF receptor ligands".
1510:, results in cellular proliferation, differentiation, and survival. 822:
positive regulation of ubiquitin-dependent protein catabolic process
7549: 7268: 6925: 6525: 6515: 6495: 6238: 6228: 5575: 5055: 4998: 4908: 4868: 4546: 4445: 4427: 4385: 4363: 4286: 4278: 4259: 4241: 4170: 4048: 3941: 3903: 3525: 1981: 1965: 1679: 1526: 1415: 1332: 832:
Wnt signaling pathway involved in dorsal/ventral axis specification
6430: 6399: 6368: 6332: 3324:: Solution structure and dynamics of the EGF/TGF-alpha chimera T1E 7524: 6945: 6410: 5812: 4773: 4450: 4417: 4412: 4404: 4291: 4226: 4097: 3855: 3700: 3639: 3334: 1973: 1827: 1368: 1118: 1073: 991: 987: 640:
transmembrane receptor protein tyrosine kinase activator activity
2053:
EGF plays an enhancer role on the osteogenic differentiation of
1443: 1402:
EGF was originally described as a secreted peptide found in the
161: 7437: 7101: 6990: 6915: 6620: 6615: 6039: 6034: 5988: 5984: 5980: 5976: 5972: 5968: 5964: 5616: 5155: 4833: 4574: 4536: 4355: 4296: 2723:
Wong L, Deb TB, Thompson SA, Wells A, Johnson GR (March 1999).
2037:
EGF is used to modify synthetic scaffolds for manufacturing of
1896: 1655:
Stimulates growth of mesenchymal cells, promotes wound healing
1534: 1514: 1513:
Salivary EGF, which seems to be regulated by dietary inorganic
1316: 1028: 601: 148:, HOMG4, URG, epidermal growth factor, epithelial growth factor 3228: 7469: 7465: 7461: 7457: 7453: 7449: 7445: 7441: 7156: 7055: 6730: 6670: 6484: 6207: 6203: 6199: 6195: 5686: 5550: 5469: 5465: 5364: 5360: 5356: 5352: 5261: 5257: 5108: 4607: 4582: 4493: 4465: 4198: 3754: 3749: 3744: 3739: 3695: 3690: 3685: 3680: 3544: 3539: 3534: 3510: 3504: 3498: 3492: 3472: 3468: 3459: 3455: 3446: 3442: 2605: 2429:
International Journal of Radiation Oncology, Biology, Physics
2294:
GMS Interdisciplinary Plastic and Reconstructive Surgery DGPW
1542: 1530: 1479: 1411: 1384: 977:
positive regulation of protein localization to early endosome
2899: 1414:. EGF has since been found in many human tissues, including 6940: 5546: 5542: 5538: 5534: 5530: 5526: 5461: 5457: 5453: 5449: 5445: 5348: 5344: 5336: 5332: 5328: 5324: 5320: 5316: 5312: 5253: 5249: 5245: 5241: 5237: 5233: 5229: 5181: 5177: 5173: 5139: 5104: 5085: 3824: 3464: 3451: 3438: 3416: 3412: 3408: 3403: 3395: 3085: 2763: 2556: 2464:
Kumar V, Abbas AK, Fausto N, Robbins SL, Cotran RS (2005).
1843: 1557:. The production of EGF has been found to be stimulated by 1538: 48: 24: 20: 1491: 817:
positive regulation of peptidyl-threonine phosphorylation
16:
Protein that stimulates cell division and differentiation
3194: 2652: 842:
positive regulation of peptidyl-tyrosine phosphorylation
417: 2463: 1582:
It has been suggested that portions of this section be
907:
positive regulation of protein tyrosine kinase activity
675:
phosphatidylinositol-4,5-bisphosphate 3-kinase activity
7540:
Pituitary adenylate cyclase-activating peptide (PACAP)
2496:(Third ed.), Academic Press, pp. 2830–2831, 1932:
All family members contain one or more repeats of the
1846:
including the gene for EGFR – that ultimately lead to
972:
positive regulation of canonical Wnt signaling pathway
812:
positive regulation of hyaluronan biosynthetic process
4672: 3873: 2287: 967:
regulation of receptor signaling pathway via JAK-STAT
582: 3294:: Crystal Structure of Human Epidermal Growth Factor 2722: 2425:"Review of epidermal growth factor receptor biology" 2081:
to be identified. Initially, human EGF was known as
1639:
Stimulates growth of epidermal and epithelial cells
837:
positive regulation of cell population proliferation
2807:
The International Journal of Lower Extremity Wounds
2288:Custo S, Baron B, Felice A, Seria E (5 July 2022). 902:
phosphatidylinositol phosphate biosynthetic process
802:
positive regulation of transcription, DNA-templated
7486:Glucose-6-phosphate isomerase (GPI; PGI, PHI, AMF) 6344:Glial cell line-derived neurotrophic factor (GDNF) 5997:Cleavage products/derivatives with unknown target: 2853:"Growth factors for treating diabetic foot ulcers" 2528:(2nd ed.). Kolkata, India: Books and Allied. 2468:(7th ed.). St. Louis, Mo: Elsevier Saunders. 2142: 2140: 2138: 2121: 2119: 2117: 1826:changes within the cell – a rise in intracellular 767:regulation of protein localization to cell surface 762:epidermal growth factor receptor signaling pathway 2457: 2391: 2203: 957:positive regulation of protein kinase B signaling 942:embryonic retina morphogenesis in camera-type eye 364: 263: 7588: 7520:Macrophage-stimulating protein (MSP; HLP, HGFLP) 5161:Heparin-binding EGF-like growth factor (HB-EGF) 4844:Heparin-binding EGF-like growth factor (HB-EGF) 2135: 2114: 1853: 1701:Stimulates development of erythropoietic cells 922:positive regulation of receptor internalization 892:regulation of peptidyl-tyrosine phosphorylation 877:positive regulation of mitotic nuclear division 2466:Robbins and Cotran pathologic basis of disease 2345: 2243: 2199: 2197: 2195: 2147:GRCm38: Ensembl release 89: ENSMUSG00000028017 962:negative regulation of Notch signaling pathway 7572:Additional growth factor receptor modulators: 4658: 3840: 3350: 3244: 2804: 2523: 2341: 2339: 2337: 2335: 2333: 2239: 2237: 2235: 1564: 937:negative regulation of ERBB signaling pathway 882:branching morphogenesis of an epithelial tube 5926:Insulin-like growth factor-2 (somatomedin A) 5808:Insulin-like growth factor-2 (somatomedin A) 5798:Insulin-like growth factor-1 (somatomedin C) 3047:. Oxford: Academic Press. pp. 129–133. 2716: 2681: 2550: 1775:Stimulates growth and maturation of T-cells 1525:The Epidermal growth factor can be found in 2857:The Cochrane Database of Systematic Reviews 2599: 2192: 2126:GRCh38: Ensembl release 89: ENSG00000138798 4665: 4651: 3847: 3833: 3357: 3343: 3251: 3237: 2846: 2844: 2330: 2232: 2011:Epidermal growth factor has been shown to 757:positive regulation of MAP kinase activity 483:Skeletal muscle tissue of rectus abdominis 30:"URG" redirects here. For other uses, see 3216:at the U.S. National Library of Medicine 3169: 3015: 3005: 2925: 2876: 2781: 2740: 2582: 2440: 2313: 2261: 1687:Inhibitory effect on cultures tumor cell 857:negative regulation of cholesterol efflux 7530:Migration-stimulating factor (MSF; PRG4) 3158:The Journal of Investigative Dermatology 2648: 2646: 1785: 1717:Stimulates the growth of sensory nerves 1664:Transforming growth factor-alpha (TGF-α) 1498:(Cys6-Cys20, Cys14-Cys31, Cys33-Cys42). 645:epidermal growth factor receptor binding 4859:Transforming growth factor alpha (TGFα) 2841: 2757: 2283: 2281: 1680:Transforming growth factor-beta (TGF-β) 7589: 7433:Connective tissue growth factor (CTGF) 3151: 3122: 2422: 2416: 1873:Heparin-binding EGF-like growth factor 1790:Diagram showing key components of the 947:positive regulation of gene expression 872:positive regulation of phosphorylation 7496:Hepatoma-derived growth factor (HDGF) 4646: 3828: 3338: 3232: 3038: 2667:10.1016/j.atherosclerosis.2005.06.038 2643: 2487: 2485: 2392:Hollenberg MD, Gregory H (May 1980). 2103:Nobel Prize in Physiology or Medicine 1822:cascade that results in a variety of 1586:out into another article titled 1520: 952:positive regulation of cell migration 369: 330: 325: 268: 227: 222: 3045:Encyclopedia of Respiratory Medicine 3043:. In Laurent GJ, Shapiro SD (eds.). 2491: 2387: 2385: 2278: 2048: 1608:Polypeptide growth factors include: 1568: 1437: 1426:. Initially, human EGF was known as 537:vestibular membrane of cochlear duct 2729:The Journal of Biological Chemistry 2250:The Journal of Biological Chemistry 13: 3364: 3078: 2502:10.1016/b978-0-12-382219-2.00624-4 2482: 2095:Washington University in St. Louis 2089:discovered EGF while working with 1864:EGF is the founding member of the 867:positive regulation of DNA binding 787:mammary gland alveolus development 14: 7618: 3188: 2382: 2244:Carpenter G, Cohen S (May 1990). 2045:or surface modification methods. 2017:epidermal growth factor receptors 1794:. In the diagram, "P" represents 862:peptidyl-tyrosine phosphorylation 7515:Leukemia inhibitory factor (LIF) 4335:5-Methoxy-N,N-dimethyltryptamine 3314: 3299: 3284: 3269: 3201:Human Protein Reference Database 3171:10.1111/j.0022-202X.2004.23308.x 2575:10.1128/MCB.25.17.7734-7742.2005 1808:epidermal growth factor receptor 1573: 1442: 807:negative regulation of secretion 782:regulation of calcium ion import 731:clathrin-coated vesicle membrane 670:protein tyrosine kinase activity 591: 549:extensor digitorum longus muscle 353: 346: 340: 317: 252: 245: 239: 214: 47: 6683:Negative allosteric modulators: 3671:Relaxin family peptide hormones 3258: 3224:EGF model in BioModels database 3032: 2981: 2942: 2893: 2798: 2783:10.1590/s1555-79602013000100004 2517: 2494:Handbook of Proteolytic Enzymes 2097:during experiments researching 2022: 2006: 1818:activity, in turn, initiates a 852:canonical Wnt signaling pathway 665:Wnt-activated receptor activity 7001:Gossypetin (3,5,7,8,3',4'-HHF) 6192:Platelet-derived growth factor 3053:10.1016/b0-12-370879-6/00138-1 2869:10.1002/14651858.CD008548.pub2 2563:Molecular and Cellular Biology 2174: 2156: 1802:EGF acts by binding with high 1648:Platelet derived growth factor 1633:Epidermal growth factor (EGF) 1549:. It can also be found in the 691:integral component of membrane 602:More reference expression data 571:More reference expression data 1: 7207:Placental growth factor (PGF) 2918:10.1080/21592535.2016.1231276 2263:10.1016/S0021-9258(19)38983-5 2218:10.1016/S0014-4827(02)00105-2 2108: 1761:Stimulates synthesis of IL-2 338: 237: 7491:Glia maturation factor (GMF) 6000:Glypromate (GPE, (1-3)IGF-1) 3854: 2442:10.1016/j.ijrobp.2003.11.041 2061:engineering applications in 1879:transforming growth factor-α 1854:EGF-family / EGF-like domain 1781: 1684:Platelets, Kidney, Placenta 1433: 1379:by binding to its receptor, 721:platelet alpha granule lumen 7: 7597:Genes on human chromosome 4 1798:. Note EGF at the very top. 1501: 917:regulation of cell motility 10: 7623: 7423:Colony-stimulating factors 7415:Additional growth factors: 4503:Insulin-like growth factor 3644:Insulin-like growth factor 3152:Howell WM (October 2004). 3088:Cell Biology International 3041:"Epidermal growth factors" 2360:10.1177/026010600902000204 2206:Experimental Cell Research 2072: 1857: 1726:Insulin-like growth factor 1565:Polypeptide growth factors 1422:(submaxillary gland), and 29: 18: 7407: 7194: 7089: 6858: 6771:SNA-120 (pegylated K252a) 6598: 6589: 6569: 6483: 6460: 6429: 6398: 6367: 6331: 6322: 6174: 6017: 5950: 5943:(against IGF-1 and IGF-2) 5912: 5905:(against IGF-1 and IGF-2) 5779: 5770: 5588: 5565: 5505: 5424: 5291: 5208: 5199: 5138: 5084: 4997: 4801: 4792: 4761: 4683: 4606: 4573: 4555: 4527: 4492: 4464: 4426: 4403: 4394: 4354: 4347: 4315: 4277: 4240: 4197: 4169: 4160: 4142: 4096: 4029: 3955: 3932: 3884: 3862: 3801: 3763: 3730: 3667: 3636: 3625: 3590: 3562: 3520: 3481: 3425: 3381: 3372: 3264: 3137:10.1016/j.clp.2004.03.015 3007:10.1186/s13005-015-0086-5 2246:"Epidermal growth factor" 2182:"Mouse PubMed Reference:" 2164:"Human PubMed Reference:" 1710:Nerve growth factor (NGF) 1395:and three intramolecular 1347: 1342: 1338: 1331: 1315: 1309:Chr 3: 129.47 – 129.55 Mb 1302:Chr 4: 109.91 – 110.01 Mb 1296: 1273: 1269: 1240: 1236: 1229: 1206: 1202: 1173: 1169: 1162: 1149: 1145: 1130: 1126: 1117: 1104: 1100: 1085: 1081: 1072: 1059: 1055: 1040: 1036: 1027: 1012: 1005: 1001: 985: 620: 616: 599: 590: 581: 568: 517: 508: 455: 446: 416: 408: 404: 387: 374: 337: 316: 307: 303: 286: 273: 236: 213: 204: 200: 155: 152: 142: 135: 130: 91: 86: 69: 64: 59: 55: 46: 41: 5607:Hepatocyte growth factor 5166:Neuregulins (heregulins) 5097:Neuregulins (heregulins) 5041:Trastuzumab duocarmazine 4754:(against angiopoietin 2) 4748:(against angiopoietin 3) 3218:Medical Subject Headings 2994:Head & Face Medicine 2819:10.1177/1534734616645444 2524:Satyanarayana U (2002). 1850:and cell proliferation. 1747:Necrosis of tumor cells 19:Not to be confused with 4954:Depatuxizumab mafodotin 3484:FGF homologous factors: 3214:Epidermal+growth+factor 3125:Clinics in Perinatology 3039:Pache JC (2006-01-01). 2742:10.1074/jbc.274.13.8900 2629:10.1126/science.6144184 1838:, and increases in the 1361:Epidermal growth factor 897:ERBB2 signaling pathway 557:vastus lateralis muscle 495:vastus lateralis muscle 7577:(neurotrophin mixture) 7565:Wnt signaling proteins 7246:Allosteric modulators: 6966:Norwogonin (5,7,8-THF) 5186:5 (tomoregulin, TMEFF) 5036:Trastuzumab deruxtecan 4674:Growth factor receptor 4330:N,N-Dimethyltryptamine 4307:Pancreatic polypeptide 3100:10.1006/cbir.1995.1086 2398:Molecular Pharmacology 2055:dental pulp stem cells 1866:EGF-family of proteins 1799: 1758:Monocytes, Leukocytes 1741:Tumor necrosis factor 1453:is missing information 777:platelet degranulation 660:growth factor activity 7505:T-cell growth factors 5762:Telisotuzumab vedotin 5046:Trastuzumab emtansine 1936:amino acid sequence: 1789: 932:membrane organization 772:ERK1 and ERK2 cascade 716:extracellular exosome 6090:EVT-901 (SAR-127963) 5823:Mecasermin rinfabate 3765:Vascular endothelial 2348:Nutrition and Health 2091:Rita Levi-Montalcini 2032:diabetic foot ulcers 1551:submandibular glands 1508:its cognate receptor 1506:EGF, via binding to 1494:. It contains three 706:extracellular region 479:gastrocnemius muscle 332:Chromosome 3 (mouse) 230:Chromosome 4 (human) 87:List of PDB id codes 60:Available structures 32:URG (disambiguation) 4616:Natriuretic peptide 3934:Posterior pituitary 3919:Somatostatin (GHIH) 2621:1984Sci...224.1107F 2099:nerve growth factor 2077:EGF was the second 2041:grafts by emulsion 1820:signal transduction 1612: 1420:submandibular gland 1404:submaxillary glands 1393:amino acid residues 887:signal transduction 726:extracellular space 650:Wnt-protein binding 635:calcium ion binding 521:submandibular gland 371:3 G3|3 58.5 cM 7256:Kinase inhibitors: 7119:Kinase inhibitors: 7018:Kinase inhibitors: 6693:Kinase inhibitors: 6508:Kinase inhibitors: 6468:Kinase inhibitors: 6449:Kinase inhibitors: 6418:Kinase inhibitors: 6387:Kinase inhibitors: 6356:Kinase inhibitors: 6216:Kinase inhibitors: 5830:Kinase inhibitors: 5624:Kinase inhibitors: 5413:Kinase inhibitors: 5406:Aprutumab ixadotin 5053:Kinase inhibitors: 4866:Kinase inhibitors: 4723:Kinase inhibitors: 3957:Anterior pituitary 3206:2005-05-03 at the 2967:10.23868/201707029 2423:Herbst RS (2004). 2306:10.3205/iprs000167 1830:levels, increased 1800: 1611: 1521:Biological sources 1107:ENSMUSG00000028017 745:Biological process 711:lysosomal membrane 684:Cellular component 628:Molecular function 7584: 7583: 7190: 7189: 6951:N-Acetylserotonin 6850:ReN-1820 (TrkAd5) 6479: 6478: 6013: 6012: 5958:Binding proteins: 5617:Dihexa (PNB-0408) 5584: 5583: 5195: 5194: 5109:6 (neuroglycan C) 4829:EGF (urogastrone) 4807: 4640: 4639: 4636: 4635: 4523: 4522: 4343: 4342: 4273: 4272: 4025: 4024: 3822: 3821: 3726: 3725: 3558: 3557: 3332: 3331: 3062:978-0-12-370879-3 2702:10.1021/bi025878c 2511:978-0-12-382219-2 2475:978-0-7216-0187-8 2435:(2 Suppl): 21–6. 2067:oral implantology 2049:Bone regeneration 1836:protein synthesis 1779: 1778: 1606: 1605: 1601: 1496:disulfide bridges 1476: 1475: 1358: 1357: 1354: 1353: 1327: 1326: 1292: 1291: 1263: 1262: 1225: 1224: 1196: 1195: 1158: 1157: 1139: 1138: 1113: 1112: 1094: 1093: 1068: 1067: 1049: 1048: 997: 996: 612: 611: 608: 607: 577: 576: 564: 563: 502: 501: 400: 399: 299: 298: 126: 125: 122: 121: 70:Ortholog search: 7614: 7396:Decoy receptors: 7369:Alacizumab pegol 6847:Decoy receptors: 6596: 6595: 6501:Stem cell factor 6442:Persephin (PSPN) 6380:Neurturin (NRTN) 6329: 6328: 6166:LEVI-04 (p75-Fc) 6163:Decoy receptors: 5777: 5776: 5206: 5205: 4805: 4799: 4798: 4667: 4660: 4653: 4644: 4643: 4401: 4400: 4396:Digestive system 4352: 4351: 4167: 4166: 4106:Thyroid hormones 3882: 3881: 3871: 3870: 3849: 3842: 3835: 3826: 3825: 3732:Platelet-derived 3674: 3647: 3634: 3633: 3528: 3486: 3432: 3389: 3379: 3378: 3359: 3352: 3345: 3336: 3335: 3318: 3303: 3288: 3273: 3253: 3246: 3239: 3230: 3229: 3183: 3173: 3148: 3119: 3073: 3072: 3070: 3069: 3036: 3030: 3029: 3019: 3009: 2985: 2979: 2978: 2946: 2940: 2939: 2929: 2897: 2891: 2890: 2880: 2863:(10): CD008548. 2848: 2839: 2838: 2802: 2796: 2795: 2785: 2761: 2755: 2754: 2744: 2720: 2714: 2713: 2685: 2679: 2678: 2650: 2641: 2640: 2615:(4653): 1107–9. 2603: 2597: 2596: 2586: 2554: 2548: 2547: 2521: 2515: 2514: 2489: 2480: 2479: 2461: 2455: 2454: 2444: 2420: 2414: 2413: 2389: 2380: 2379: 2343: 2328: 2327: 2317: 2300:(Doc06): Doc06. 2285: 2276: 2275: 2265: 2241: 2230: 2229: 2201: 2190: 2189: 2178: 2172: 2171: 2160: 2154: 2144: 2133: 2123: 1792:MAPK/ERK pathway 1668:Epithelial cell 1613: 1610: 1597: 1577: 1576: 1569: 1471: 1468: 1462: 1446: 1438: 1371:that stimulates 1340: 1339: 1311: 1304: 1287: 1267: 1266: 1258: 1234: 1233: 1230:RefSeq (protein) 1220: 1200: 1199: 1191: 1167: 1166: 1143: 1142: 1124: 1123: 1098: 1097: 1079: 1078: 1053: 1052: 1034: 1033: 1003: 1002: 701:receptor complex 618: 617: 604: 595: 588: 587: 573: 553:plantaris muscle 545:lobe of prostate 513: 511:Top expressed in 506: 505: 463:body of pancreas 451: 449:Top expressed in 444: 443: 423: 422: 406: 405: 396: 383: 372: 357: 350: 344: 333: 321: 305: 304: 295: 282: 271: 256: 249: 243: 232: 218: 202: 201: 196: 147: 140: 117: 84: 83: 78: 57: 56: 51: 39: 38: 7622: 7621: 7617: 7616: 7615: 7613: 7612: 7611: 7587: 7586: 7585: 7580: 7525:Midkine (NEGF2) 7403: 7186: 7085: 6854: 6792:ABT-110 (PG110) 6585: 6565: 6475: 6456: 6425: 6394: 6363: 6318: 6170: 6108:ABT-110 (PG110) 6009: 5946: 5908: 5766: 5580: 5561: 5501: 5498:(against FGF23) 5420: 5287: 5191: 5134: 5080: 4993: 4804: 4788: 4757: 4679: 4671: 4641: 4632: 4602: 4569: 4551: 4519: 4488: 4460: 4422: 4390: 4339: 4311: 4269: 4236: 4193: 4156: 4138: 4122: 4114: 4092: 4076:Adrenal medulla 4069:Androstenedione 4021: 3951: 3928: 3876: 3865: 3858: 3853: 3823: 3818: 3797: 3759: 3722: 3668: 3663: 3637: 3628: 3621: 3586: 3564:EGF-like domain 3554: 3521: 3516: 3482: 3477: 3426: 3421: 3382: 3368: 3363: 3333: 3328: 3325: 3319: 3310: 3304: 3295: 3289: 3280: 3274: 3260: 3257: 3208:Wayback Machine 3191: 3186: 3081: 3079:Further reading 3076: 3067: 3065: 3063: 3037: 3033: 2986: 2982: 2947: 2943: 2912:(1): e1231276. 2898: 2894: 2849: 2842: 2803: 2799: 2762: 2758: 2721: 2717: 2696:(27): 8732–41. 2686: 2682: 2655:Atherosclerosis 2651: 2644: 2604: 2600: 2569:(17): 7734–42. 2555: 2551: 2536: 2522: 2518: 2512: 2490: 2483: 2476: 2462: 2458: 2421: 2417: 2390: 2383: 2344: 2331: 2286: 2279: 2256:(14): 7709–12. 2242: 2233: 2202: 2193: 2180: 2179: 2175: 2162: 2161: 2157: 2145: 2136: 2124: 2115: 2111: 2075: 2051: 2043:electrospinning 2025: 2009: 1997:disulfide bonds 1988:represents any 1957: 1955: 1951: 1947: 1943: 1862: 1860:EGF-like domain 1856: 1816:tyrosine kinase 1784: 1714:Salivary gland 1695:Erythropoietin 1671:Similar to EGF 1636:Salivary gland 1625:Major function 1602: 1578: 1574: 1567: 1523: 1504: 1472: 1466: 1463: 1456: 1447: 1436: 1397:disulfide bonds 1377:differentiation 1349:View/Edit Mouse 1344:View/Edit Human 1307: 1300: 1297:Location (UCSC) 1283: 1279: 1275: 1254: 1250: 1246: 1242: 1216: 1212: 1208: 1187: 1183: 1179: 1175: 1088:ENSG00000138798 981: 797:DNA replication 740: 736:plasma membrane 679: 655:protein binding 600: 569: 560: 555: 551: 547: 543: 539: 535: 531: 527: 523: 509: 498: 493: 489: 485: 481: 477: 473: 469: 467:muscle of thigh 465: 461: 447: 391: 378: 370: 360: 359: 358: 351: 331: 308:Gene location ( 290: 277: 269: 259: 258: 257: 250: 228: 205:Gene location ( 194:EGF - orthologs 156: 143: 136: 93: 71: 35: 28: 17: 12: 11: 5: 7620: 7610: 7609: 7604: 7602:Growth factors 7599: 7582: 7581: 7579: 7578: 7568: 7567: 7562: 7555:Thrombopoietin 7552: 7547: 7542: 7537: 7532: 7527: 7522: 7517: 7512: 7498: 7493: 7488: 7483: 7476:Erythropoietin 7473: 7435: 7430: 7420: 7418:Adrenomedullin 7411: 7409: 7405: 7404: 7402: 7401: 7392: 7391: 7386: 7381: 7376: 7371: 7362: 7361: 7356: 7351: 7346: 7341: 7336: 7331: 7326: 7321: 7316: 7311: 7306: 7301: 7296: 7291: 7286: 7281: 7276: 7271: 7266: 7261: 7252: 7251: 7242: 7241: 7219: 7214: 7209: 7200: 7198: 7192: 7191: 7188: 7187: 7185: 7184: 7179: 7174: 7169: 7164: 7159: 7154: 7149: 7144: 7139: 7134: 7129: 7124: 7115: 7114: 7109: 7104: 7095: 7093: 7087: 7086: 7084: 7083: 7078: 7073: 7068: 7063: 7058: 7053: 7048: 7043: 7038: 7033: 7028: 7023: 7014: 7013: 7004: 7003: 6998: 6993: 6984: 6983: 6978: 6973: 6968: 6963: 6958: 6953: 6948: 6943: 6938: 6933: 6928: 6923: 6918: 6913: 6908: 6903: 6898: 6893: 6888: 6883: 6881:4'-DMA-7,8-DHF 6878: 6873: 6864: 6862: 6856: 6855: 6853: 6852: 6843: 6842: 6830: 6829: 6824: 6819: 6814: 6809: 6804: 6799: 6794: 6775: 6774: 6768: 6763: 6758: 6753: 6748: 6743: 6738: 6733: 6728: 6723: 6718: 6713: 6708: 6703: 6698: 6689: 6688: 6679: 6678: 6673: 6668: 6663: 6654: 6653: 6648: 6643: 6641:Gambogic amide 6638: 6633: 6628: 6623: 6618: 6613: 6604: 6602: 6593: 6587: 6586: 6584: 6583: 6575: 6573: 6567: 6566: 6564: 6563: 6558: 6553: 6548: 6543: 6538: 6533: 6528: 6523: 6518: 6513: 6504: 6503: 6498: 6489: 6487: 6481: 6480: 6477: 6476: 6474: 6473: 6464: 6462: 6458: 6457: 6455: 6454: 6445: 6444: 6435: 6433: 6427: 6426: 6424: 6423: 6414: 6413: 6411:Artemin (ARTN) 6404: 6402: 6396: 6395: 6393: 6392: 6383: 6382: 6373: 6371: 6365: 6364: 6362: 6361: 6352: 6351: 6346: 6337: 6335: 6326: 6320: 6319: 6317: 6316: 6311: 6306: 6297: 6296: 6291: 6286: 6281: 6276: 6271: 6266: 6261: 6256: 6251: 6246: 6241: 6236: 6231: 6226: 6221: 6212: 6211: 6189: 6180: 6178: 6172: 6171: 6169: 6168: 6159: 6158: 6146: 6145: 6140: 6135: 6130: 6125: 6120: 6115: 6110: 6098: 6097: 6092: 6087: 6082: 6073: 6072: 6067: 6062: 6057: 6052: 6047: 6042: 6037: 6032: 6023: 6021: 6015: 6014: 6011: 6010: 6008: 6007: 6002: 5993: 5992: 5954: 5952: 5948: 5947: 5945: 5944: 5938: 5929: 5928: 5918: 5916: 5910: 5909: 5907: 5906: 5900: 5895: 5890: 5885: 5880: 5875: 5870: 5865: 5856: 5855: 5850: 5845: 5840: 5835: 5826: 5825: 5820: 5815: 5810: 5805: 5800: 5795: 5785: 5783: 5774: 5768: 5767: 5765: 5764: 5759: 5754: 5749: 5744: 5739: 5734: 5725: 5724: 5719: 5714: 5709: 5704: 5699: 5694: 5689: 5684: 5679: 5674: 5669: 5664: 5659: 5654: 5649: 5644: 5639: 5634: 5629: 5620: 5619: 5610: 5609: 5604: 5594: 5592: 5586: 5585: 5582: 5581: 5579: 5578: 5569: 5567: 5563: 5562: 5560: 5559: 5554: 5520: 5511: 5509: 5503: 5502: 5500: 5499: 5489: 5488: 5483: 5478: 5473: 5439: 5430: 5428: 5422: 5421: 5419: 5418: 5409: 5408: 5403: 5394: 5393: 5388: 5383: 5378: 5373: 5368: 5306: 5297: 5295: 5289: 5288: 5286: 5285: 5280: 5275: 5270: 5265: 5223: 5214: 5212: 5203: 5197: 5196: 5193: 5192: 5190: 5189: 5163: 5158: 5153: 5144: 5142: 5136: 5135: 5133: 5132: 5127: 5122: 5113: 5112: 5090: 5088: 5082: 5081: 5079: 5078: 5073: 5068: 5063: 5058: 5049: 5048: 5043: 5038: 5033: 5028: 5023: 5014: 5013: 5003: 5001: 4995: 4994: 4992: 4991: 4986: 4981: 4976: 4971: 4966: 4961: 4956: 4951: 4946: 4937: 4936: 4931: 4926: 4921: 4916: 4911: 4906: 4901: 4896: 4891: 4886: 4881: 4876: 4871: 4862: 4861: 4856: 4851: 4846: 4841: 4836: 4831: 4826: 4821: 4811: 4809: 4796: 4790: 4789: 4787: 4786: 4781: 4776: 4767: 4765: 4759: 4758: 4756: 4755: 4749: 4739: 4738: 4733: 4728: 4719: 4718: 4716:Angiopoietin 3 4713: 4711:Angiopoietin 2 4704: 4703: 4701:Angiopoietin 4 4698: 4696:Angiopoietin 1 4689: 4687: 4681: 4680: 4670: 4669: 4662: 4655: 4647: 4638: 4637: 4634: 4633: 4631: 4630: 4629: 4628: 4623: 4612: 4610: 4604: 4603: 4601: 4600: 4595: 4590: 4585: 4579: 4577: 4571: 4570: 4568: 4567: 4561: 4559: 4553: 4552: 4550: 4549: 4544: 4539: 4533: 4531: 4529:Adipose tissue 4525: 4524: 4521: 4520: 4518: 4517: 4516: 4515: 4510: 4499: 4497: 4490: 4489: 4487: 4486: 4481: 4476: 4474:Enteroglucagon 4470: 4468: 4462: 4461: 4459: 4458: 4453: 4448: 4443: 4438: 4432: 4430: 4424: 4423: 4421: 4420: 4415: 4409: 4407: 4398: 4392: 4391: 4389: 4388: 4383: 4378: 4377: 4376: 4374:Beta thymosins 4371: 4360: 4358: 4349: 4345: 4344: 4341: 4340: 4338: 4337: 4332: 4327: 4321: 4319: 4313: 4312: 4310: 4309: 4304: 4299: 4294: 4289: 4283: 4281: 4275: 4274: 4271: 4270: 4268: 4267: 4262: 4257: 4252: 4246: 4244: 4238: 4237: 4235: 4234: 4229: 4224: 4219: 4214: 4209: 4203: 4201: 4195: 4194: 4192: 4191: 4186: 4181: 4175: 4173: 4164: 4158: 4157: 4155: 4154: 4148: 4146: 4140: 4139: 4137: 4136: 4131: 4126: 4125: 4124: 4120: 4116: 4112: 4102: 4100: 4094: 4093: 4091: 4090: 4089: 4088: 4086:Norepinephrine 4083: 4073: 4072: 4071: 4066: 4061: 4056: 4051: 4046: 4039:Adrenal cortex 4035: 4033: 4027: 4026: 4023: 4022: 4020: 4019: 4014: 4013: 4012: 4007: 4002: 3997: 3992: 3982: 3977: 3972: 3967: 3961: 3959: 3953: 3952: 3950: 3949: 3944: 3938: 3936: 3930: 3929: 3927: 3926: 3921: 3916: 3911: 3906: 3901: 3896: 3890: 3888: 3879: 3868: 3860: 3859: 3852: 3851: 3844: 3837: 3829: 3820: 3819: 3817: 3816: 3811: 3805: 3803: 3799: 3798: 3796: 3795: 3790: 3785: 3780: 3775: 3769: 3767: 3761: 3760: 3758: 3757: 3752: 3747: 3742: 3736: 3734: 3728: 3727: 3724: 3723: 3721: 3720: 3719: 3718: 3713: 3708: 3698: 3693: 3688: 3683: 3677: 3675: 3665: 3664: 3662: 3661: 3656: 3650: 3648: 3631: 3629:Relaxin family 3623: 3622: 3620: 3619: 3618: 3617: 3612: 3607: 3596: 3594: 3588: 3587: 3585: 3584: 3579: 3574: 3568: 3566: 3560: 3559: 3556: 3555: 3553: 3552: 3547: 3542: 3537: 3531: 3529: 3518: 3517: 3515: 3514: 3508: 3502: 3496: 3489: 3487: 3479: 3478: 3476: 3475: 3462: 3449: 3435: 3433: 3423: 3422: 3420: 3419: 3406: 3392: 3390: 3376: 3370: 3369: 3366:Growth factors 3362: 3361: 3354: 3347: 3339: 3330: 3329: 3327: 3326: 3320: 3313: 3311: 3305: 3298: 3296: 3290: 3283: 3281: 3275: 3268: 3265: 3262: 3261: 3256: 3255: 3248: 3241: 3233: 3227: 3226: 3221: 3211: 3197: 3190: 3189:External links 3187: 3185: 3184: 3149: 3120: 3082: 3080: 3077: 3075: 3074: 3061: 3031: 2980: 2957:(in Russian). 2941: 2892: 2840: 2797: 2756: 2735:(13): 8900–9. 2715: 2680: 2642: 2598: 2549: 2534: 2516: 2510: 2481: 2474: 2456: 2415: 2404:(3): 314–320. 2381: 2329: 2277: 2231: 2191: 2173: 2155: 2134: 2112: 2110: 2107: 2074: 2071: 2050: 2047: 2024: 2021: 2008: 2005: 1953: 1949: 1945: 1941: 1939: 1930: 1929: 1923: 1917: 1911: 1905: 1899: 1894: 1888: 1882: 1876: 1858:Main article: 1855: 1852: 1810:(EGFR) on the 1783: 1780: 1777: 1776: 1773: 1770: 1769:Interleukin-2 1767: 1763: 1762: 1759: 1756: 1755:Interleukin-1 1753: 1749: 1748: 1745: 1742: 1739: 1735: 1734: 1731: 1728: 1723: 1719: 1718: 1715: 1712: 1707: 1703: 1702: 1699: 1696: 1693: 1689: 1688: 1685: 1682: 1677: 1673: 1672: 1669: 1666: 1661: 1657: 1656: 1653: 1650: 1645: 1641: 1640: 1637: 1634: 1631: 1627: 1626: 1623: 1620: 1619:Growth factor 1617: 1604: 1603: 1581: 1579: 1572: 1566: 1563: 1522: 1519: 1503: 1500: 1488:molecular mass 1474: 1473: 1450: 1448: 1441: 1435: 1432: 1356: 1355: 1352: 1351: 1346: 1336: 1335: 1329: 1328: 1325: 1324: 1322: 1320: 1313: 1312: 1305: 1298: 1294: 1293: 1290: 1289: 1271: 1270: 1264: 1261: 1260: 1238: 1237: 1231: 1227: 1226: 1223: 1222: 1204: 1203: 1197: 1194: 1193: 1171: 1170: 1164: 1160: 1159: 1156: 1155: 1147: 1146: 1140: 1137: 1136: 1128: 1127: 1121: 1115: 1114: 1111: 1110: 1102: 1101: 1095: 1092: 1091: 1083: 1082: 1076: 1070: 1069: 1066: 1065: 1057: 1056: 1050: 1047: 1046: 1038: 1037: 1031: 1025: 1024: 1019: 1014: 1010: 1009: 999: 998: 995: 994: 983: 982: 980: 979: 974: 969: 964: 959: 954: 949: 944: 939: 934: 929: 924: 919: 914: 909: 904: 899: 894: 889: 884: 879: 874: 869: 864: 859: 854: 849: 844: 839: 834: 829: 824: 819: 814: 809: 804: 799: 794: 789: 784: 779: 774: 769: 764: 759: 754: 748: 746: 742: 741: 739: 738: 733: 728: 723: 718: 713: 708: 703: 698: 693: 687: 685: 681: 680: 678: 677: 672: 667: 662: 657: 652: 647: 642: 637: 631: 629: 625: 624: 614: 613: 610: 609: 606: 605: 597: 596: 585: 579: 578: 575: 574: 566: 565: 562: 561: 559: 558: 554: 550: 546: 542: 538: 534: 530: 526: 522: 518: 515: 514: 503: 500: 499: 497: 496: 492: 491:deltoid muscle 488: 487:biceps brachii 484: 480: 476: 472: 468: 464: 460: 456: 453: 452: 440: 439: 431: 420: 414: 413: 410:RNA expression 402: 401: 398: 397: 389: 385: 384: 376: 373: 368: 362: 361: 352: 345: 339: 335: 334: 329: 323: 322: 314: 313: 301: 300: 297: 296: 288: 284: 283: 275: 272: 267: 261: 260: 251: 244: 238: 234: 233: 226: 220: 219: 211: 210: 198: 197: 154: 150: 149: 141: 133: 132: 128: 127: 124: 123: 120: 119: 89: 88: 80: 79: 68: 62: 61: 53: 52: 44: 43: 15: 9: 6: 4: 3: 2: 7619: 7608: 7605: 7603: 7600: 7598: 7595: 7594: 7592: 7576: 7573: 7570: 7569: 7566: 7563: 7560: 7556: 7553: 7551: 7548: 7546: 7543: 7541: 7538: 7536: 7533: 7531: 7528: 7526: 7523: 7521: 7518: 7516: 7513: 7510: 7506: 7502: 7499: 7497: 7494: 7492: 7489: 7487: 7484: 7481: 7477: 7474: 7471: 7467: 7463: 7459: 7455: 7451: 7447: 7443: 7439: 7436: 7434: 7431: 7428: 7424: 7421: 7419: 7416: 7413: 7412: 7410: 7406: 7400: 7397: 7394: 7393: 7390: 7387: 7385: 7382: 7380: 7377: 7375: 7372: 7370: 7367: 7364: 7363: 7360: 7357: 7355: 7352: 7350: 7347: 7345: 7342: 7340: 7337: 7335: 7332: 7330: 7327: 7325: 7322: 7320: 7317: 7315: 7312: 7310: 7307: 7305: 7302: 7300: 7297: 7295: 7292: 7290: 7287: 7285: 7282: 7280: 7277: 7275: 7272: 7270: 7267: 7265: 7262: 7260: 7257: 7254: 7253: 7250: 7249:Cyclotraxin B 7247: 7244: 7243: 7239: 7235: 7231: 7227: 7223: 7220: 7218: 7215: 7213: 7210: 7208: 7205: 7202: 7201: 7199: 7197: 7193: 7183: 7180: 7178: 7175: 7173: 7170: 7168: 7165: 7163: 7162:Larotrectinib 7160: 7158: 7155: 7153: 7150: 7148: 7145: 7143: 7140: 7138: 7135: 7133: 7130: 7128: 7125: 7123: 7120: 7117: 7116: 7113: 7110: 7108: 7105: 7103: 7100: 7097: 7096: 7094: 7092: 7088: 7082: 7079: 7077: 7074: 7072: 7069: 7067: 7064: 7062: 7061:Larotrectinib 7059: 7057: 7054: 7052: 7049: 7047: 7044: 7042: 7039: 7037: 7034: 7032: 7029: 7027: 7024: 7022: 7019: 7016: 7015: 7012: 7009: 7006: 7005: 7002: 6999: 6997: 6996:Cyclotraxin B 6994: 6992: 6989: 6986: 6985: 6982: 6979: 6977: 6974: 6972: 6969: 6967: 6964: 6962: 6959: 6957: 6954: 6952: 6949: 6947: 6944: 6942: 6939: 6937: 6934: 6932: 6929: 6927: 6924: 6922: 6919: 6917: 6914: 6912: 6909: 6907: 6906:Amitriptyline 6904: 6902: 6899: 6897: 6894: 6892: 6889: 6887: 6884: 6882: 6879: 6877: 6874: 6872: 6869: 6866: 6865: 6863: 6861: 6857: 6851: 6848: 6845: 6844: 6841: 6838: 6835: 6832: 6831: 6828: 6825: 6823: 6820: 6818: 6815: 6813: 6810: 6808: 6805: 6803: 6800: 6798: 6795: 6793: 6790: 6786: 6783: 6782:Against TrkA: 6780: 6777: 6776: 6772: 6769: 6767: 6764: 6762: 6759: 6757: 6754: 6752: 6749: 6747: 6744: 6742: 6739: 6737: 6736:Larotrectinib 6734: 6732: 6729: 6727: 6724: 6722: 6719: 6717: 6714: 6712: 6709: 6707: 6704: 6702: 6699: 6697: 6694: 6691: 6690: 6687: 6684: 6681: 6680: 6677: 6674: 6672: 6669: 6667: 6666:Dexamethasone 6664: 6662: 6659: 6656: 6655: 6652: 6649: 6647: 6644: 6642: 6639: 6637: 6634: 6632: 6629: 6627: 6624: 6622: 6619: 6617: 6614: 6612: 6611:Amitriptyline 6609: 6606: 6605: 6603: 6601: 6597: 6594: 6592: 6588: 6581: 6577: 6576: 6574: 6572: 6568: 6562: 6559: 6557: 6554: 6552: 6549: 6547: 6544: 6542: 6539: 6537: 6534: 6532: 6529: 6527: 6524: 6522: 6519: 6517: 6514: 6512: 6509: 6506: 6505: 6502: 6499: 6497: 6494: 6491: 6490: 6488: 6486: 6482: 6472: 6469: 6466: 6465: 6463: 6459: 6453: 6450: 6447: 6446: 6443: 6440: 6437: 6436: 6434: 6432: 6428: 6422: 6419: 6416: 6415: 6412: 6409: 6406: 6405: 6403: 6401: 6397: 6391: 6388: 6385: 6384: 6381: 6378: 6375: 6374: 6372: 6370: 6366: 6360: 6357: 6354: 6353: 6350: 6347: 6345: 6342: 6339: 6338: 6336: 6334: 6330: 6327: 6325: 6321: 6315: 6312: 6310: 6307: 6305: 6302: 6299: 6298: 6295: 6292: 6290: 6287: 6285: 6282: 6280: 6277: 6275: 6272: 6270: 6267: 6265: 6262: 6260: 6257: 6255: 6252: 6250: 6247: 6245: 6242: 6240: 6237: 6235: 6232: 6230: 6227: 6225: 6222: 6220: 6217: 6214: 6213: 6209: 6205: 6201: 6197: 6193: 6190: 6188: 6185: 6182: 6181: 6179: 6177: 6173: 6167: 6164: 6161: 6160: 6157: 6154: 6151: 6148: 6147: 6144: 6141: 6139: 6136: 6134: 6131: 6129: 6126: 6124: 6121: 6119: 6116: 6114: 6111: 6109: 6106: 6103: 6100: 6099: 6096: 6093: 6091: 6088: 6086: 6085:Dexamethasone 6083: 6081: 6078: 6075: 6074: 6071: 6068: 6066: 6063: 6061: 6058: 6056: 6053: 6051: 6048: 6046: 6043: 6041: 6038: 6036: 6033: 6031: 6028: 6025: 6024: 6022: 6020: 6016: 6006: 6003: 6001: 5998: 5995: 5994: 5990: 5986: 5982: 5978: 5974: 5970: 5966: 5962: 5959: 5956: 5955: 5953: 5949: 5942: 5939: 5937: 5934: 5931: 5930: 5927: 5923: 5920: 5919: 5917: 5915: 5911: 5904: 5901: 5899: 5896: 5894: 5891: 5889: 5886: 5884: 5881: 5879: 5876: 5874: 5871: 5869: 5866: 5864: 5861: 5858: 5857: 5854: 5851: 5849: 5846: 5844: 5841: 5839: 5836: 5834: 5831: 5828: 5827: 5824: 5821: 5819: 5816: 5814: 5811: 5809: 5806: 5804: 5801: 5799: 5796: 5794: 5793:des(1-3)IGF-1 5790: 5787: 5786: 5784: 5782: 5778: 5775: 5773: 5769: 5763: 5760: 5758: 5757:Telisotuzumab 5755: 5753: 5750: 5748: 5745: 5743: 5740: 5738: 5735: 5733: 5730: 5727: 5726: 5723: 5720: 5718: 5715: 5713: 5710: 5708: 5705: 5703: 5700: 5698: 5695: 5693: 5690: 5688: 5685: 5683: 5680: 5678: 5675: 5673: 5670: 5668: 5665: 5663: 5660: 5658: 5655: 5653: 5650: 5648: 5645: 5643: 5640: 5638: 5635: 5633: 5630: 5628: 5625: 5622: 5621: 5618: 5615: 5614:Potentiators: 5612: 5611: 5608: 5605: 5603: 5599: 5596: 5595: 5593: 5591: 5587: 5577: 5574: 5571: 5570: 5568: 5564: 5558: 5555: 5552: 5548: 5544: 5540: 5536: 5532: 5528: 5524: 5521: 5519: 5516: 5513: 5512: 5510: 5508: 5504: 5497: 5494: 5491: 5490: 5487: 5484: 5482: 5479: 5477: 5476:Selpercatinib 5474: 5471: 5467: 5463: 5459: 5455: 5451: 5447: 5443: 5440: 5438: 5435: 5432: 5431: 5429: 5427: 5423: 5417: 5414: 5411: 5410: 5407: 5404: 5402: 5399: 5396: 5395: 5392: 5389: 5387: 5384: 5382: 5381:Selpercatinib 5379: 5377: 5374: 5372: 5369: 5366: 5362: 5358: 5354: 5350: 5346: 5342: 5338: 5334: 5330: 5326: 5322: 5318: 5314: 5310: 5307: 5305: 5302: 5299: 5298: 5296: 5294: 5290: 5284: 5281: 5279: 5276: 5274: 5273:Selpercatinib 5271: 5269: 5266: 5263: 5259: 5255: 5251: 5247: 5243: 5239: 5235: 5231: 5227: 5224: 5222: 5219: 5216: 5215: 5213: 5211: 5207: 5204: 5202: 5198: 5187: 5183: 5179: 5175: 5171: 5167: 5164: 5162: 5159: 5157: 5154: 5152: 5149: 5146: 5145: 5143: 5141: 5137: 5131: 5128: 5126: 5123: 5121: 5118: 5115: 5114: 5110: 5106: 5102: 5098: 5095: 5092: 5091: 5089: 5087: 5083: 5077: 5074: 5072: 5069: 5067: 5064: 5062: 5059: 5057: 5054: 5051: 5050: 5047: 5044: 5042: 5039: 5037: 5034: 5032: 5029: 5027: 5024: 5022: 5019: 5016: 5015: 5012: 5008: 5005: 5004: 5002: 5000: 4996: 4990: 4987: 4985: 4982: 4980: 4977: 4975: 4972: 4970: 4967: 4965: 4962: 4960: 4957: 4955: 4952: 4950: 4949:Depatuxizumab 4947: 4945: 4942: 4939: 4938: 4935: 4932: 4930: 4927: 4925: 4922: 4920: 4917: 4915: 4912: 4910: 4907: 4905: 4902: 4900: 4897: 4895: 4892: 4890: 4887: 4885: 4882: 4880: 4877: 4875: 4872: 4870: 4867: 4864: 4863: 4860: 4857: 4855: 4852: 4850: 4847: 4845: 4842: 4840: 4837: 4835: 4832: 4830: 4827: 4825: 4822: 4820: 4816: 4813: 4812: 4810: 4808: 4800: 4797: 4795: 4791: 4785: 4782: 4780: 4777: 4775: 4772: 4769: 4768: 4766: 4764: 4760: 4753: 4750: 4747: 4744: 4741: 4740: 4737: 4734: 4732: 4729: 4727: 4724: 4721: 4720: 4717: 4714: 4712: 4709: 4706: 4705: 4702: 4699: 4697: 4694: 4691: 4690: 4688: 4686: 4682: 4678: 4675: 4668: 4663: 4661: 4656: 4654: 4649: 4648: 4645: 4627: 4624: 4622: 4619: 4618: 4617: 4614: 4613: 4611: 4609: 4605: 4599: 4598:Prostaglandin 4596: 4594: 4591: 4589: 4586: 4584: 4581: 4580: 4578: 4576: 4572: 4566: 4563: 4562: 4560: 4558: 4554: 4548: 4545: 4543: 4540: 4538: 4535: 4534: 4532: 4530: 4526: 4514: 4511: 4509: 4506: 4505: 4504: 4501: 4500: 4498: 4495: 4491: 4485: 4482: 4480: 4477: 4475: 4472: 4471: 4469: 4467: 4463: 4457: 4454: 4452: 4449: 4447: 4444: 4442: 4439: 4437: 4434: 4433: 4431: 4429: 4425: 4419: 4416: 4414: 4411: 4410: 4408: 4406: 4402: 4399: 4397: 4393: 4387: 4384: 4382: 4379: 4375: 4372: 4370: 4367: 4366: 4365: 4362: 4361: 4359: 4357: 4353: 4350: 4346: 4336: 4333: 4331: 4328: 4326: 4323: 4322: 4320: 4318: 4314: 4308: 4305: 4303: 4300: 4298: 4295: 4293: 4290: 4288: 4285: 4284: 4282: 4280: 4276: 4266: 4263: 4261: 4258: 4256: 4253: 4251: 4248: 4247: 4245: 4243: 4239: 4233: 4230: 4228: 4225: 4223: 4220: 4218: 4215: 4213: 4210: 4208: 4205: 4204: 4202: 4200: 4196: 4190: 4187: 4185: 4182: 4180: 4177: 4176: 4174: 4172: 4168: 4165: 4163: 4159: 4153: 4150: 4149: 4147: 4145: 4141: 4135: 4132: 4130: 4127: 4123: 4117: 4115: 4109: 4108: 4107: 4104: 4103: 4101: 4099: 4095: 4087: 4084: 4082: 4079: 4078: 4077: 4074: 4070: 4067: 4065: 4062: 4060: 4057: 4055: 4052: 4050: 4047: 4045: 4042: 4041: 4040: 4037: 4036: 4034: 4032: 4028: 4018: 4015: 4011: 4008: 4006: 4003: 4001: 3998: 3996: 3993: 3991: 3988: 3987: 3986: 3983: 3981: 3978: 3976: 3973: 3971: 3968: 3966: 3963: 3962: 3960: 3958: 3954: 3948: 3945: 3943: 3940: 3939: 3937: 3935: 3931: 3925: 3922: 3920: 3917: 3915: 3912: 3910: 3907: 3905: 3902: 3900: 3897: 3895: 3892: 3891: 3889: 3887: 3883: 3880: 3878: 3875:Hypothalamic– 3872: 3869: 3867: 3861: 3857: 3850: 3845: 3843: 3838: 3836: 3831: 3830: 3827: 3815: 3812: 3810: 3807: 3806: 3804: 3800: 3794: 3791: 3789: 3786: 3784: 3781: 3779: 3776: 3774: 3771: 3770: 3768: 3766: 3762: 3756: 3753: 3751: 3748: 3746: 3743: 3741: 3738: 3737: 3735: 3733: 3729: 3717: 3714: 3712: 3709: 3707: 3704: 3703: 3702: 3699: 3697: 3694: 3692: 3689: 3687: 3684: 3682: 3679: 3678: 3676: 3673: 3672: 3666: 3660: 3657: 3655: 3652: 3651: 3649: 3646: 3645: 3641: 3635: 3632: 3630: 3624: 3616: 3613: 3611: 3608: 3606: 3603: 3602: 3601: 3598: 3597: 3595: 3593: 3589: 3583: 3580: 3578: 3575: 3573: 3570: 3569: 3567: 3565: 3561: 3551: 3548: 3546: 3543: 3541: 3538: 3536: 3533: 3532: 3530: 3527: 3524: 3523:hormone-like: 3519: 3512: 3509: 3506: 3503: 3500: 3497: 3494: 3491: 3490: 3488: 3485: 3480: 3474: 3470: 3466: 3463: 3461: 3457: 3453: 3450: 3448: 3444: 3440: 3437: 3436: 3434: 3431: 3430: 3424: 3418: 3414: 3410: 3407: 3405: 3401: 3397: 3394: 3393: 3391: 3388: 3386: 3380: 3377: 3375: 3371: 3367: 3360: 3355: 3353: 3348: 3346: 3341: 3340: 3337: 3323: 3317: 3312: 3308: 3302: 3297: 3293: 3287: 3282: 3278: 3272: 3267: 3266: 3263: 3254: 3249: 3247: 3242: 3240: 3235: 3234: 3231: 3225: 3222: 3219: 3215: 3212: 3209: 3205: 3202: 3198: 3196: 3193: 3192: 3181: 3177: 3172: 3167: 3164:(4): xx–xxi. 3163: 3159: 3155: 3150: 3146: 3142: 3138: 3134: 3131:(1): 183–92. 3130: 3126: 3121: 3117: 3113: 3109: 3105: 3101: 3097: 3094:(5): 413–30. 3093: 3089: 3084: 3083: 3064: 3058: 3054: 3050: 3046: 3042: 3035: 3027: 3023: 3018: 3013: 3008: 3003: 2999: 2995: 2991: 2984: 2976: 2972: 2968: 2964: 2960: 2956: 2955:Гены и клетки 2952: 2945: 2937: 2933: 2928: 2923: 2919: 2915: 2911: 2907: 2903: 2896: 2888: 2884: 2879: 2874: 2870: 2866: 2862: 2858: 2854: 2847: 2845: 2836: 2832: 2828: 2824: 2820: 2816: 2812: 2808: 2801: 2793: 2789: 2784: 2779: 2775: 2771: 2770:MEDICC Review 2767: 2760: 2752: 2748: 2743: 2738: 2734: 2730: 2726: 2719: 2711: 2707: 2703: 2699: 2695: 2691: 2684: 2676: 2672: 2668: 2664: 2660: 2656: 2649: 2647: 2638: 2634: 2630: 2626: 2622: 2618: 2614: 2610: 2602: 2594: 2590: 2585: 2580: 2576: 2572: 2568: 2564: 2560: 2553: 2545: 2541: 2537: 2531: 2527: 2520: 2513: 2507: 2503: 2499: 2495: 2488: 2486: 2477: 2471: 2467: 2460: 2452: 2448: 2443: 2438: 2434: 2430: 2426: 2419: 2411: 2407: 2403: 2399: 2395: 2388: 2386: 2377: 2373: 2369: 2365: 2361: 2357: 2354:(2): 119–34. 2353: 2349: 2342: 2340: 2338: 2336: 2334: 2325: 2321: 2316: 2311: 2307: 2303: 2299: 2295: 2291: 2284: 2282: 2273: 2269: 2264: 2259: 2255: 2251: 2247: 2240: 2238: 2236: 2227: 2223: 2219: 2215: 2211: 2207: 2200: 2198: 2196: 2187: 2183: 2177: 2169: 2165: 2159: 2152: 2148: 2143: 2141: 2139: 2131: 2127: 2122: 2120: 2118: 2113: 2106: 2104: 2100: 2096: 2092: 2088: 2087:Stanley Cohen 2084: 2080: 2079:growth factor 2070: 2068: 2064: 2060: 2056: 2046: 2044: 2040: 2039:bioengineered 2035: 2033: 2029: 2020: 2018: 2014: 2004: 2002: 1998: 1993: 1991: 1987: 1983: 1979: 1975: 1971: 1967: 1963: 1958: 1937: 1935: 1927: 1924: 1921: 1918: 1915: 1912: 1909: 1906: 1903: 1900: 1898: 1895: 1892: 1889: 1886: 1883: 1880: 1877: 1874: 1871: 1870: 1869: 1867: 1861: 1851: 1849: 1848:DNA synthesis 1845: 1841: 1837: 1833: 1829: 1825: 1821: 1817: 1813: 1809: 1805: 1797: 1793: 1788: 1774: 1771: 1768: 1765: 1764: 1760: 1757: 1754: 1751: 1750: 1746: 1743: 1740: 1737: 1736: 1732: 1729: 1727: 1724: 1721: 1720: 1716: 1713: 1711: 1708: 1705: 1704: 1700: 1697: 1694: 1691: 1690: 1686: 1683: 1681: 1678: 1675: 1674: 1670: 1667: 1665: 1662: 1659: 1658: 1654: 1651: 1649: 1646: 1643: 1642: 1638: 1635: 1632: 1629: 1628: 1624: 1621: 1618: 1615: 1614: 1609: 1600: 1599:(August 2022) 1595: 1591: 1590: 1589:Growth factor 1585: 1580: 1571: 1570: 1562: 1560: 1556: 1555:parotid gland 1552: 1548: 1544: 1540: 1536: 1532: 1528: 1518: 1516: 1511: 1509: 1499: 1497: 1493: 1489: 1485: 1482:, EGF has 53 1481: 1470: 1467:December 2023 1460: 1454: 1451:This section 1449: 1445: 1440: 1439: 1431: 1429: 1425: 1424:parotid gland 1421: 1417: 1413: 1410:and in human 1409: 1405: 1400: 1398: 1394: 1390: 1386: 1382: 1378: 1374: 1370: 1366: 1362: 1350: 1345: 1341: 1337: 1334: 1330: 1323: 1321: 1318: 1314: 1310: 1306: 1303: 1299: 1295: 1288: 1286: 1282: 1278: 1272: 1268: 1265: 1259: 1257: 1253: 1249: 1245: 1239: 1235: 1232: 1228: 1221: 1219: 1215: 1211: 1205: 1201: 1198: 1192: 1190: 1186: 1182: 1178: 1172: 1168: 1165: 1163:RefSeq (mRNA) 1161: 1154: 1153: 1148: 1144: 1141: 1135: 1134: 1129: 1125: 1122: 1120: 1116: 1109: 1108: 1103: 1099: 1096: 1090: 1089: 1084: 1080: 1077: 1075: 1071: 1064: 1063: 1058: 1054: 1051: 1045: 1044: 1039: 1035: 1032: 1030: 1026: 1023: 1020: 1018: 1015: 1011: 1008: 1004: 1000: 993: 989: 984: 978: 975: 973: 970: 968: 965: 963: 960: 958: 955: 953: 950: 948: 945: 943: 940: 938: 935: 933: 930: 928: 925: 923: 920: 918: 915: 913: 910: 908: 905: 903: 900: 898: 895: 893: 890: 888: 885: 883: 880: 878: 875: 873: 870: 868: 865: 863: 860: 858: 855: 853: 850: 848: 845: 843: 840: 838: 835: 833: 830: 828: 825: 823: 820: 818: 815: 813: 810: 808: 805: 803: 800: 798: 795: 793: 790: 788: 785: 783: 780: 778: 775: 773: 770: 768: 765: 763: 760: 758: 755: 753: 750: 749: 747: 744: 743: 737: 734: 732: 729: 727: 724: 722: 719: 717: 714: 712: 709: 707: 704: 702: 699: 697: 694: 692: 689: 688: 686: 683: 682: 676: 673: 671: 668: 666: 663: 661: 658: 656: 653: 651: 648: 646: 643: 641: 638: 636: 633: 632: 630: 627: 626: 623: 622:Gene ontology 619: 615: 603: 598: 594: 589: 586: 584: 580: 572: 567: 556: 552: 548: 544: 540: 536: 533:parotid gland 532: 528: 524: 520: 519: 516: 512: 507: 504: 494: 490: 486: 482: 478: 475:kidney tubule 474: 470: 466: 462: 459:renal medulla 458: 457: 454: 450: 445: 442: 441: 438: 436: 432: 430: 429: 425: 424: 421: 419: 415: 411: 407: 403: 395: 390: 386: 382: 377: 367: 363: 356: 349: 343: 336: 328: 324: 320: 315: 311: 306: 302: 294: 289: 285: 281: 276: 266: 262: 255: 248: 242: 235: 231: 225: 221: 217: 212: 208: 203: 199: 195: 191: 187: 183: 179: 175: 171: 167: 163: 159: 151: 146: 139: 134: 129: 118: 116: 112: 108: 104: 100: 96: 90: 85: 82: 81: 77: 74: 67: 63: 58: 54: 50: 45: 40: 37: 33: 26: 22: 7575:Cerebrolysin 7571: 7545:Pleiotrophin 7501:Interleukins 7414: 7395: 7365: 7284:Fruquintinib 7274:Cabozantinib 7255: 7245: 7203: 7167:Lestaurtinib 7118: 7098: 7066:Lestaurtinib 7017: 7007: 6988:Antagonists: 6987: 6921:Deoxygedunin 6876:3,7,8,2'-THF 6867: 6846: 6837:Against NGF: 6836: 6833: 6789:Against NGF: 6788: 6781: 6778: 6741:Lestaurtinib 6692: 6682: 6676:Testosterone 6658:Antagonists: 6657: 6607: 6507: 6492: 6467: 6448: 6438: 6417: 6407: 6386: 6376: 6355: 6340: 6300: 6215: 6183: 6162: 6153:Against NGF: 6152: 6149: 6105:Against NGF: 6104: 6101: 6095:Testosterone 6077:Antagonists: 6076: 6026: 5996: 5957: 5932: 5921: 5898:Teprotumumab 5859: 5829: 5788: 5737:Ficlatuzumab 5732:Emibetuzumab 5728: 5682:JNJ-38877605 5652:Cabozantinib 5623: 5613: 5602:Fosgonimeton 5597: 5572: 5514: 5492: 5433: 5416:Infigratinib 5412: 5397: 5300: 5217: 5151:Betacellulin 5147: 5130:Seribantumab 5116: 5093: 5052: 5017: 5011:Unknown/none 5010: 5006: 4940: 4865: 4828: 4824:Betacellulin 4819:Amphiregulin 4814: 4806:(ErbB1/HER1) 4770: 4742: 4722: 4708:Antagonists: 4707: 4692: 4685:Angiopoietin 4381:Thymopoietin 4317:Pineal gland 4302:Somatostatin 4265:Progesterone 4212:Progesterone 4179:Testosterone 4162:Gonadal axis 4134:Thyroid axis 4031:Adrenal axis 3886:Hypothalamus 3669: 3638: 3627:Insulin/IGF/ 3592:TGFβ pathway 3576: 3522: 3483: 3427: 3385:FGF receptor 3383: 3321: 3306: 3291: 3276: 3161: 3157: 3128: 3124: 3091: 3087: 3066:. Retrieved 3044: 3034: 2997: 2993: 2983: 2961:(4): 47–52. 2958: 2954: 2944: 2909: 2905: 2895: 2860: 2856: 2813:(2): 120–5. 2810: 2806: 2800: 2773: 2769: 2759: 2732: 2728: 2718: 2693: 2690:Biochemistry 2689: 2683: 2661:(1): 38–53. 2658: 2654: 2612: 2608: 2601: 2566: 2562: 2552: 2526:Biochemistry 2525: 2519: 2493: 2465: 2459: 2432: 2428: 2418: 2401: 2397: 2351: 2347: 2297: 2293: 2253: 2249: 2209: 2205: 2185: 2176: 2167: 2158: 2082: 2076: 2063:periodontics 2052: 2036: 2026: 2023:Medical uses 2010: 2007:Interactions 2001:cell-surface 1994: 1985: 1977: 1969: 1961: 1959: 1938: 1931: 1926:neuregulin-4 1920:neuregulin-3 1914:neuregulin-2 1908:neuregulin-1 1902:Betacellulin 1885:Amphiregulin 1863: 1812:cell surface 1801: 1772:Lymphocytes 1607: 1598: 1587: 1559:testosterone 1547:blood plasma 1524: 1512: 1505: 1490:of around 6 1477: 1464: 1452: 1427: 1401: 1364: 1360: 1359: 1281:NP_001316523 1277:NP_001297666 1274: 1256:NP_001343950 1248:NP_001171602 1244:NP_001171601 1241: 1218:NM_001329594 1214:NM_001310737 1207: 1189:NM_001357021 1181:NM_001178131 1177:NM_001178130 1174: 1150: 1131: 1105: 1086: 1060: 1041: 1021: 1016: 827:angiogenesis 792:MAPK cascade 529:right kidney 525:human kidney 471:human kidney 433: 426: 392:129,548,965 379:129,471,214 291:110,013,766 278:109,912,883 153:External IDs 92: 36: 7535:Oncomodulin 7399:Aflibercept 7389:Ranibizumab 7384:Ramucirumab 7374:Bevacizumab 7366:Antibodies: 7324:Regorafenib 7264:Altiratinib 7177:ONO-5390556 7147:Entrectinib 7122:Altiratinib 7076:ONO-5390556 7046:Entrectinib 7021:Altiratinib 6807:Frunevetmab 6779:Antibodies: 6756:ONO-5390556 6721:Entrectinib 6696:Altiratinib 6651:Tavilermide 6546:Quizartinib 6485:SCF (c-Kit) 6309:Ramucirumab 6301:Antibodies: 6274:Quizartinib 6224:Avapritinib 6187:Becaplermin 6123:Frunevetmab 6102:Antibodies: 6005:Trofinetide 5936:Dusigitumab 5933:Antibodies: 5888:Robatumumab 5878:Figitumumab 5873:Dalotuzumab 5868:Cixutumumab 5860:Antibodies: 5752:Rilotumumab 5747:Onartuzumab 5742:Flanvotumab 5729:Antibodies: 5697:PF-04217903 5627:Altiratinib 5590:HGF (c-Met) 5493:Antibodies: 5398:Antibodies: 5120:Duligotumab 5117:Antibodies: 5031:Trastuzumab 5021:Ertumaxomab 5018:Antibodies: 4989:Zalutumumab 4984:Panitumumab 4979:Nimotuzumab 4974:Necitumumab 4964:Imgatuzumab 4941:Antibodies: 4924:Osimertinib 4889:Dacomitinib 4784:Dapiclermin 4743:Antibodies: 4726:Altiratinib 4565:Osteocalcin 4542:Adiponectin 4369:Thymosin α1 4144:Parathyroid 4044:Aldosterone 3947:Vasopressin 3259:PDB gallery 3199:EGF at the 2776:(1): 11–5. 2212:(1): 2–13. 2083:urogastrone 2059:bone tissue 2028:Recombinant 2003:receptors. 1842:of certain 1824:biochemical 1484:amino acids 1428:urogastrone 1391:and has 53 1373:cell growth 131:Identifiers 7607:Morphogens 7591:Categories 7354:Vandetanib 7319:Rebastinib 7314:Pegaptanib 7304:Nintedanib 7294:Lenvatinib 7259:Agerafenib 7212:Ripretinib 7137:CH-7057288 7036:CH-7057288 6901:7,8,3'-THF 6896:7,8,2'-THF 6822:Ranevetmab 6812:Fulranumab 6766:Rebastinib 6711:CH-7057288 6626:Cenegermin 6511:Agerafenib 6471:Agerafenib 6452:Vandetanib 6421:Vandetanib 6390:Vandetanib 6359:Vandetanib 6304:Olaratumab 6279:Ripretinib 6259:Nintedanib 6244:Lenvatinib 6234:Crenolanib 6219:Agerafenib 6138:Ranevetmab 6128:Fulranumab 6045:Cenegermin 6019:LNGF (p75) 5941:Xentuzumab 5903:Xentuzumab 5848:NVP-AEW541 5843:NVP-ADW742 5838:Linsitinib 5833:BMS-754807 5818:Mecasermin 5717:Tivantinib 5707:PHA-665752 5702:PF-2341066 5672:Golvatinib 5662:Crizotinib 5657:Capmatinib 5647:BMS-777607 5642:Amuvatinib 5518:Ersofermin 5481:Sprifermin 5437:Ersofermin 5386:Sprifermin 5376:Repifermin 5371:Palifermin 5304:Ersofermin 5283:Velafermin 5268:Repifermin 5221:Ersofermin 5140:ErbB4/HER4 5125:Patritumab 5086:ErbB3/HER3 5066:Mubritinib 5026:Pertuzumab 4999:ErbB2/HER2 4929:Vandetanib 4884:Canertinib 4879:Brigatinib 4874:Agerafenib 4854:Nepidermin 4849:Murodermin 4839:Epiregulin 4794:EGF (ErbB) 4752:Nesvacumab 4746:Evinacumab 4736:Rebastinib 4677:modulators 4593:Calcitriol 4479:Peptide YY 4129:Calcitonin 4081:Adrenaline 4010:Lipotropin 4005:Endorphins 3814:Hepatocyte 3374:Fibroblast 3068:2020-11-30 2535:8187134801 2153:, May 2017 2132:, May 2017 2109:References 1990:amino acid 1891:Epiregulin 1840:expression 1832:glycolysis 1744:Monocytes 1652:Platelets 1553:, and the 1387:EGF is 6-k 437:(ortholog) 174:HomoloGene 7379:Icrucumab 7359:WHI-P 154 7349:Tivozanib 7344:Toceranib 7339:Sunitinib 7334:Sorafenib 7329:Semaxanib 7309:Pazopanib 7299:Motesanib 7289:Lapatinib 7279:Cediranib 7217:Telbermin 7204:Agonists: 7152:GZ-389988 7132:CE-245677 7099:Agonists: 7051:GZ-389988 7031:CE-245677 6931:Diosmetin 6868:Agonists: 6834:Aptamers: 6827:Tanezumab 6802:Fasinumab 6746:Milciclib 6726:GZ-389988 6706:CE-245677 6608:Agonists: 6561:Toceranib 6556:Sunitinib 6551:Sorafenib 6541:Pazopanib 6536:Nilotinib 6531:Masitinib 6521:Dasatinib 6493:Agonists: 6439:Agonists: 6408:Agonists: 6377:Agonists: 6349:Liatermin 6341:Agonists: 6324:RET (GFL) 6314:Tovetumab 6294:Toceranib 6289:Sorafenib 6284:Sunitinib 6269:Radotinib 6264:Pazopanib 6254:Motesanib 6249:Masitinib 6184:Agonists: 6150:Aptamers: 6143:Tanezumab 6118:Fasinumab 6027:Agonists: 5883:Ganitumab 5803:IGF-1 LR3 5722:Volitinib 5677:INCB28060 5667:Foretinib 5573:Agonists: 5557:Trafermin 5515:Agonists: 5496:Burosumab 5486:Trafermin 5434:Agonists: 5401:Aprutumab 5391:Trafermin 5353:10 (KGF2) 5301:Agonists: 5278:Trafermin 5258:10 (KGF2) 5218:Agonists: 5148:Agonists: 5094:Agonists: 5076:Tucatinib 5071:Neratinib 5061:Lapatinib 4969:Matuzumab 4959:Futuximab 4944:Cetuximab 4934:WHI-P 154 4919:Neratinib 4914:Lapatinib 4904:Grandinin 4899:Gefitinib 4894:Erlotinib 4771:Agonists: 4731:CE-245677 4693:Agonists: 4364:Thymosins 4325:Melatonin 4207:Estradiol 4054:Cortisone 3980:Prolactin 3877:pituitary 3864:Endocrine 2906:Biomatter 1934:conserved 1796:phosphate 1782:Mechanism 1527:platelets 1459:talk page 1434:Structure 1416:platelets 1285:NP_034243 1252:NP_001954 1210:NM_010113 1185:NM_001963 1007:Orthologs 182:GeneCards 7561:instead) 7550:Renalase 7511:instead) 7482:instead) 7429:instead) 7269:Axitinib 7238:D (FIGF) 7182:PLX-7486 7172:ONO-4474 7127:AZD-6918 7081:PLX-7486 7071:ONO-4474 7026:AZD-6918 7008:Ligands: 6926:Deprenyl 6886:7,3'-DHF 6817:MEDI-578 6797:ASP-6294 6761:PLX-7486 6751:ONO-4474 6701:AZD-6918 6661:ALE-0540 6582:instead. 6526:Imatinib 6516:Axitinib 6496:Ancestim 6461:Unsorted 6239:Imatinib 6229:Axitinib 6133:MEDI-578 6113:ASP-6294 6080:ALE-0540 5922:Agonists 5863:AVE-1642 5789:Agonists 5712:SU-11274 5598:Agonists 5576:FGF15/19 5566:Unsorted 5531:2 (bFGF) 5450:2 (bFGF) 5317:2 (bFGF) 5234:2 (bFGF) 5056:Afatinib 5007:Agonists 4909:Icotinib 4869:Afatinib 4815:Agonists 4557:Skeleton 4547:Resistin 4446:Secretin 4428:Duodenum 4386:Thymulin 4287:Glucagon 4279:Pancreas 4260:Estrogen 4242:Placenta 4049:Cortisol 3942:Oxytocin 3904:Dopamine 3856:Hormones 3526:FGF15/19 3387:ligands: 3204:Archived 3180:15373802 3145:15183666 3116:20186286 3026:26334535 2975:90593089 2936:27740881 2887:26509249 2835:43897291 2827:27151755 2792:23396236 2751:10085134 2710:12093292 2675:16076471 2593:16107719 2544:71209231 2451:15142631 2376:25710052 2368:19835108 2324:35909816 2226:12648462 2149:– 2128:– 2013:interact 1982:arginine 1966:cysteine 1875:(HB-EGF) 1804:affinity 1502:Function 1333:Wikidata 986:Sources: 696:membrane 541:prostate 7438:Ephrins 7142:DS-6051 7041:DS-6051 6946:LM22A-4 6936:DMAQ-B1 6891:7,8-DHF 6871:3,7-DHF 6840:RBM-004 6785:GBR-900 6716:DS-6051 6686:VM-902A 6156:RBM-004 5853:OSl-906 5813:Insulin 5692:MK-2461 5637:AMG-458 4774:Axokine 4451:Motilin 4418:Ghrelin 4413:Gastrin 4405:Stomach 4292:Insulin 4227:Relaxin 4222:Inhibin 4217:Activin 4189:Inhibin 4098:Thyroid 3701:Relaxin 3640:Insulin 3108:7640657 3017:4558932 2927:5098722 2878:8665376 2637:6144184 2617:Bibcode 2609:Science 2584:1190273 2410:6248761 2315:9284722 2272:2186024 2151:Ensembl 2130:Ensembl 2093:at the 2073:History 1974:glycine 1928:(NRG4). 1881:(TGF-α) 1828:calcium 1698:Kidney 1622:Source 1594:Discuss 1369:protein 1367:) is a 1119:UniProt 1074:Ensembl 1013:Species 992:QuickGO 412:pattern 138:Aliases 7408:Others 7102:BNN-20 6991:ANA-12 6916:BNN-20 6636:DHEA-S 6621:BNN-27 6616:BNN-20 6055:DHEA-S 6040:BNN-27 6035:BNN-20 5951:Others 5156:Epigen 4834:Epigen 4575:Kidney 4537:Leptin 4496:/other 4356:Thymus 4297:Amylin 4171:Testis 4064:DHEA-S 3866:glands 3788:VEGF-D 3783:VEGF-C 3778:VEGF-B 3773:VEGF-A 3582:HB-EGF 3513:(FHF4) 3507:(FHF2) 3501:(FHF1) 3495:(FHF3) 3220:(MeSH) 3178:  3143:  3114:  3106:  3059:  3024:  3014:  3000:: 29. 2973:  2934:  2924:  2885:  2875:  2833:  2825:  2790:  2749:  2708:  2673:  2635:  2591:  2581:  2542:  2532:  2508:  2472:  2449:  2408:  2374:  2366:  2322:  2312:  2270:  2224:  1984:, and 1960:Where 1922:(NRG3) 1916:(NRG2) 1910:(NRG1) 1897:Epigen 1730:Serum 1616:Sr.No 1545:, and 1535:saliva 1515:iodine 1480:humans 1319:search 1317:PubMed 1152:P01132 1133:P01133 1029:Entrez 583:BioGPS 162:131530 7557:(see 7507:(see 7478:(see 7425:(see 7157:K252a 7056:K252a 6731:K252a 6671:FX007 6431:GFRα4 6400:GFRα3 6369:GFRα2 6333:GFRα1 5961:IGFBP 5914:IGF-2 5893:R1507 5781:IGF-1 5687:K252a 5507:FGFR4 5426:FGFR3 5293:FGFR2 5210:FGFR1 4608:Heart 4583:Renin 4513:IGF-2 4508:IGF-1 4494:Liver 4484:GLP-1 4466:Ileum 4348:Other 4232:GnSAF 4199:Ovary 3809:Nerve 3802:Other 3755:PDGFD 3750:PDGFC 3745:PDGFB 3740:PDGFA 3696:INSL6 3691:INSL5 3686:INSL4 3681:INSL3 3615:TGFβ3 3610:TGFβ2 3605:TGFβ1 3550:FGF23 3545:FGF21 3540:FGF19 3535:FGF15 3511:FGF14 3505:FGF13 3499:FGF12 3493:FGF11 3473:FGF20 3469:FGF16 3460:FGF18 3456:FGF17 3447:FGF22 3443:FGF10 3112:S2CID 2971:S2CID 2831:S2CID 2372:S2CID 2015:with 1950:10-13 1904:(BTC) 1893:(EPR) 1844:genes 1584:split 1543:tears 1531:urine 1412:urine 1385:Human 1062:13645 1022:Mouse 1017:Human 988:Amigo 435:Mouse 428:Human 375:Start 310:Mouse 274:Start 207:Human 170:95290 7559:here 7509:here 7480:here 7427:here 7222:VEGF 7196:VEGF 7112:NT-3 7107:DHEA 7091:TrkC 7011:DHEA 6981:TDP6 6961:NT-4 6956:NT-3 6941:HIOC 6911:BDNF 6860:TrkB 6631:DHEA 6600:TrkA 6580:here 6578:See 6571:TGFβ 6176:PDGF 6070:NT-4 6065:NT-3 6050:DHEA 6030:BDNF 4779:CNTF 4763:CNTF 4059:DHEA 3995:ACTH 3990:CLIP 3985:POMC 3914:GHRH 3894:GnRH 3659:IGF2 3654:IGF1 3642:and 3600:TGFβ 3572:TGFα 3465:FGF9 3452:FGF8 3439:FGF7 3417:FGF6 3413:FGF4 3409:FGF3 3404:FGF5 3400:FGF2 3396:FGF1 3322:1p9j 3307:1nql 3292:1jl9 3277:1ivo 3176:PMID 3141:PMID 3104:PMID 3057:ISBN 3022:PMID 2932:PMID 2883:PMID 2861:2015 2823:PMID 2788:PMID 2747:PMID 2706:PMID 2671:PMID 2633:PMID 2589:PMID 2540:OCLC 2530:ISBN 2506:ISBN 2470:ISBN 2447:PMID 2406:PMID 2364:PMID 2320:PMID 2268:PMID 2222:PMID 2065:and 1956:GXRC 1952:CXCX 1887:(AR) 1834:and 1539:milk 1408:mice 1381:EGFR 1375:and 1043:1950 418:Bgee 366:Band 327:Chr. 270:4q25 265:Band 224:Chr. 178:1483 158:OMIM 115:3NJP 111:2KV4 107:1P9J 103:1NQL 99:1JL9 95:1IVO 76:RCSB 73:PDBe 25:VEGF 21:EF-G 6976:R13 6646:NGF 6591:Trk 6060:NGF 5772:IGF 5632:AM7 5523:FGF 5442:FGF 5343:), 5341:KGF 5309:FGF 5226:FGF 5201:FGF 4803:EGF 4626:BNP 4621:ANP 4588:EPO 4456:VIP 4441:GIP 4436:CCK 4255:HPL 4250:hCG 4184:AMH 4152:PTH 4000:MSH 3975:TSH 3965:FSH 3924:MCH 3909:CRH 3899:TRH 3793:PGF 3577:EGF 3429:KGF 3166:doi 3162:123 3133:doi 3096:doi 3049:doi 3012:PMC 3002:doi 2963:doi 2922:PMC 2914:doi 2873:PMC 2865:doi 2815:doi 2778:doi 2737:doi 2733:274 2698:doi 2663:doi 2659:186 2625:doi 2613:224 2579:PMC 2571:doi 2498:doi 2437:doi 2356:doi 2310:PMC 2302:doi 2258:doi 2254:265 2214:doi 2210:284 1980:is 1972:is 1964:is 1946:4-5 1806:to 1766:10 1592:. ( 1492:kDa 1478:In 1406:of 1365:EGF 388:End 287:End 190:OMA 186:EGF 166:MGI 145:EGF 66:PDB 42:EGF 23:or 7593:: 7470:B3 7468:, 7466:B2 7464:, 7462:B1 7460:, 7458:A5 7456:, 7454:A4 7452:, 7450:A3 7448:, 7446:A2 7444:, 7442:A1 7236:, 7232:, 7228:, 6971:R7 6787:; 6206:, 6202:, 6198:, 5987:, 5983:, 5979:, 5975:, 5971:, 5967:, 5924:: 5791:: 5600:: 5551:19 5549:, 5545:, 5541:, 5537:, 5533:, 5529:, 5470:23 5468:, 5466:18 5464:, 5460:, 5456:, 5452:, 5448:, 5365:22 5363:, 5361:18 5359:, 5357:17 5355:, 5351:, 5347:, 5335:, 5331:, 5327:, 5323:, 5319:, 5315:, 5262:20 5260:, 5256:, 5252:, 5248:, 5244:, 5240:, 5236:, 5232:, 5184:, 5180:, 5176:, 5172:, 5107:, 5103:, 5009:: 4817:: 4017:GH 3970:LH 3174:. 3160:. 3156:. 3139:. 3129:31 3127:. 3110:. 3102:. 3092:19 3090:. 3055:. 3020:. 3010:. 2998:11 2996:. 2992:. 2969:. 2959:12 2953:. 2930:. 2920:. 2908:. 2904:. 2881:. 2871:. 2859:. 2855:. 2843:^ 2829:. 2821:. 2811:15 2809:. 2786:. 2774:15 2772:. 2768:. 2745:. 2731:. 2727:. 2704:. 2694:41 2692:. 2669:. 2657:. 2645:^ 2631:. 2623:. 2611:. 2587:. 2577:. 2567:25 2565:. 2561:. 2538:. 2504:, 2484:^ 2445:. 2433:59 2431:. 2427:. 2402:17 2400:. 2396:. 2384:^ 2370:. 2362:. 2352:20 2350:. 2332:^ 2318:. 2308:. 2298:11 2296:. 2292:. 2280:^ 2266:. 2252:. 2248:. 2234:^ 2220:. 2208:. 2194:^ 2184:. 2166:. 2137:^ 2116:^ 2105:. 2085:. 2069:. 2019:. 1992:. 1976:, 1968:, 1948:CX 1944:CX 1940:CX 1752:9 1738:8 1722:7 1706:6 1692:5 1676:4 1660:3 1644:2 1630:1 1596:) 1561:. 1541:, 1537:, 1533:, 1529:, 1430:. 1418:, 1399:. 1389:Da 1383:. 990:/ 394:bp 381:bp 293:bp 280:bp 188:; 184:: 180:; 176:: 172:; 168:: 164:; 160:: 113:, 109:, 105:, 101:, 97:, 7503:/ 7472:) 7440:( 7240:) 7234:C 7230:B 7226:A 7224:( 6773:) 6210:) 6208:D 6204:C 6200:B 6196:A 6194:( 5991:) 5989:7 5985:6 5981:5 5977:4 5973:3 5969:2 5965:1 5963:( 5553:) 5547:9 5543:8 5539:6 5535:4 5527:1 5525:( 5472:) 5462:9 5458:8 5454:4 5446:1 5444:( 5367:) 5349:9 5345:8 5339:( 5337:7 5333:6 5329:5 5325:4 5321:3 5313:1 5311:( 5264:) 5254:8 5250:6 5246:5 5242:4 5238:3 5230:1 5228:( 5188:) 5182:4 5178:3 5174:2 5170:1 5168:( 5111:) 5105:2 5101:1 5099:( 4666:e 4659:t 4652:v 4121:4 4119:T 4113:3 4111:T 3848:e 3841:t 3834:v 3716:3 3711:2 3706:1 3471:/ 3467:/ 3458:/ 3454:/ 3445:/ 3441:/ 3415:/ 3411:/ 3402:/ 3398:/ 3358:e 3351:t 3344:v 3252:e 3245:t 3238:v 3210:. 3182:. 3168:: 3147:. 3135:: 3118:. 3098:: 3071:. 3051:: 3028:. 3004:: 2977:. 2965:: 2938:. 2916:: 2910:6 2889:. 2867:: 2837:. 2817:: 2794:. 2780:: 2753:. 2739:: 2712:. 2700:: 2677:. 2665:: 2639:. 2627:: 2619:: 2595:. 2573:: 2546:. 2500:: 2478:. 2453:. 2439:: 2412:. 2378:. 2358:: 2326:. 2304:: 2274:. 2260:: 2228:. 2216:: 2188:. 2170:. 1986:X 1978:R 1970:G 1962:C 1954:8 1942:7 1469:) 1465:( 1461:. 1363:( 312:) 209:) 192:: 34:. 27:.

Index

EF-G
VEGF
URG (disambiguation)

PDB
PDBe
RCSB
1IVO
1JL9
1NQL
1P9J
2KV4
3NJP
Aliases
EGF
OMIM
131530
MGI
95290
HomoloGene
1483
GeneCards
EGF
OMA
EGF - orthologs
Human
Chromosome 4 (human)
Chr.
Chromosome 4 (human)
Chromosome 4 (human)

Text is available under the Creative Commons Attribution-ShareAlike License. Additional terms may apply.